Recombinant human Prohibitin protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag1240
Synonyms
PHB, PHB1, Prohibitin 1, Cell and organelle markers, mitochondria
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ
(1-272 aa encoded by BC013401) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
