PHGDH Monoclonal antibody, PBS Only

• 

  WB analysis using 67591-1-Ig (same clone as 67591-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67591-1-Ig (PHGDH antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67591-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 67591-1-Ig (same clone as 67591-1-PBS)

  IP result of anti-PHGDH (IP:67591-1-Ig, 4ug; Detection:67591-1-Ig 1:3000) with HeLa cells lysate 980 ug. This data was developed using the same antibody clone with 67591-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human urothelial carcinoma using 67591-1-Ig (same clone as 67591-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 67591-1-Ig (PHGDH antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67591-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67591-1-Ig (same clone as 67591-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using PHGDH antibody (67591-1-Ig, Clone: 1E8B8 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 67591-1-PBS in a different storage buffer formulation.

PHGDH Monoclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 67591-1-PBS

Clone No.1E8B8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

EC:1.1.1.37, D-3-phosphoglycerate dehydrogenase, 3-PGDH, 3PGDH, 3 PGDH

---

Product Information

67591-1-PBS targets PHGDH in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6877

  Product name: Recombinant human PHGDH protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 186-533 aa of BC000303

  Sequence: FGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF

• Full Name: phosphoglycerate dehydrogenase
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC000303
• Gene Symbol: PHGDH
• Gene ID (NCBI): 26227
• RRID: AB_2882799
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O43175
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PHGDH(D-3-phosphoglycerate dehydrogenase) is also named as 3-PGDH, PGDH3 and belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. It catalyzes the transition of 3-phosphoglycerate into 3-phosphohydroxypyruvate, which is the first and rate-limiting step in the phosphorylated pathway of serine biosynthesis, using NAD+/NADH as a cofactor. 3-PGDH deficiency is a rare recessive inborn error in the biosynthesis of the amino acid L-serine characterized clinically by congenital microcephaly, psychomotor retardation, and intractable seizures(PMID:19235232 ).