PHLPP2 Polyclonal antibody, PBS Only

• 

  WB analysis using 25244-1-AP (same clone as 25244-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25244-1-AP (PHLPP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25244-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 25244-1-AP (same clone as 25244-1-PBS)

  WB result of PHLPP2 antibody (25244-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PHLPP2 transfected HeLa cells. This data was developed using the same antibody clone with 25244-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 25244-1-AP (same clone as 25244-1-PBS)

  IP result of anti-PHLPP2 (IP:25244-1-AP, 4ug; Detection:25244-1-AP 1:500) with HeLa cells lysate 1880 ug. This data was developed using the same antibody clone with 25244-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 25244-1-AP (same clone as 25244-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 25244-1-AP (PHLPP2 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 25244-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 25244-1-AP (same clone as 25244-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 25244-1-AP (PHLPP2 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 25244-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 25244-1-AP (same clone as 25244-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 25244-1-AP (PHLPP2 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 25244-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 25244-1-AP (same clone as 25244-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 25244-1-AP (PHLPP2 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 25244-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 25244-1-AP (same clone as 25244-1-PBS)

  Immunofluorescent analysis of HeLa cells using 25244-1-AP (PHLPP2 antibody) at dilution of 1:25 and Rhodamine-Goat anti-Rabbit IgG. This data was developed using the same antibody clone with 25244-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PHLPP2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 25244-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

PHLPPL, EC:3.1.3.16, KIAA0931, PH domain leucine-rich repeat-containing protein phosphatase 2, PH domain leucine-rich repeat-containing protein phosphatase-like

---

Product Information

25244-1-PBS targets PHLPP2 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19000

  Product name: Recombinant human PHLPPL protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 575-781 aa of BC129927

  Sequence: LDLQHNALTRLPDTLFSKALNLRYLNASANSLESLPSACTGEESLSMLQLLYLTNNLLTDQCIPVLVGHLHLRILHLANNQLQTFPASKLNKLEQLEELNLSGNKLKTIPTTIANCKRLHTLVAHSNNISIFPEILQLPQIQFVDLSCNDLTEILIPEALPATLQDLDLTGNTNLVLEHKTLDIFSHITTLKIDQKPLPTTDSTVTS

• Full Name: PH domain and leucine rich repeat protein phosphatase-like
• Calculated Molecular Weight: 1323 aa, 147 kDa
• Observed Molecular Weight: 147 kDa
• GenBank Accession Number: BC129927
• Gene Symbol: PHLPPL
• Gene ID (NCBI): 23035
• RRID: AB_2879985
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6ZVD8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PHLPP2 also named as PHLPPL is a 1323 amino acid protein, which contains 22 LRR repeats, 1 PH domain and 1 PP2C-like domain. Localized to both the nucleus and the cytoplasm, PHLPPL uses manganese as a cofactor and mediates the dephosphorylation of Akt1, thereby playing a role in cell survival and apoptotic regulation. Multiple isoforms of PHLPPL exist due to alternative splicing events.