Tested Applications
| Positive WB detected in | HeLa cells, NIH/3T3 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human colon cancer tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25244-1-AP targets PHLPP2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19000 Product name: Recombinant human PHLPPL protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 575-781 aa of BC129927 Sequence: LDLQHNALTRLPDTLFSKALNLRYLNASANSLESLPSACTGEESLSMLQLLYLTNNLLTDQCIPVLVGHLHLRILHLANNQLQTFPASKLNKLEQLEELNLSGNKLKTIPTTIANCKRLHTLVAHSNNISIFPEILQLPQIQFVDLSCNDLTEILIPEALPATLQDLDLTGNTNLVLEHKTLDIFSHITTLKIDQKPLPTTDSTVTS Predict reactive species |
| Full Name | PH domain and leucine rich repeat protein phosphatase-like |
| Calculated Molecular Weight | 1323 aa, 147 kDa |
| Observed Molecular Weight | 147 kDa |
| GenBank Accession Number | BC129927 |
| Gene Symbol | PHLPPL |
| Gene ID (NCBI) | 23035 |
| RRID | AB_2879985 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6ZVD8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PHLPP2 also named as PHLPPL is a 1323 amino acid protein, which contains 22 LRR repeats, 1 PH domain and 1 PP2C-like domain. Localized to both the nucleus and the cytoplasm, PHLPPL uses manganese as a cofactor and mediates the dephosphorylation of Akt1, thereby playing a role in cell survival and apoptotic regulation. Multiple isoforms of PHLPPL exist due to alternative splicing events.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PHLPP2 antibody 25244-1-AP | Download protocol |
| IHC protocol for PHLPP2 antibody 25244-1-AP | Download protocol |
| IP protocol for PHLPP2 antibody 25244-1-AP | Download protocol |
| WB protocol for PHLPP2 antibody 25244-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PHLPP2 Polyclonal antibody (Cat# 25244-1-AP) has 23 citations. These appear in journals including Cell Metabolism, Cell Death Discovery, Oncotarget, British Journal of Cancer, FASEB Journal, iScience, Cancer Medicine, and Toxicology & Applied Pharmacology. Research fields span oncology (lung, gastric, breast, bladder, colon, and head-and-neck cancers), PI3K-AKT signaling, m6A RNA methylation, glucose metabolism, diabetic retinopathy, and vascular development.
| Species | Application | Title |
|---|---|---|
Cell Metab m6A mRNA methylation in brown fat regulates systemic insulin sensitivity via an inter-organ prostaglandin signaling axis independent of UCP1 | ||
Cell Death Discov PHLPP regulates hexokinase 2-dependent glucose metabolism in colon cancer cells.
| ||
Br J Cancer LAMB3 drives gastric cancer progression through SAMD4A-mediated degradation of PHLPP2 mRNA leading to sustained PI3K-Akt activation. | ||
Oxid Med Cell Longev Colonic Epithelial PHLPP2 Deficiency Promotes Colonic Epithelial Pyroptosis by Activating the NF-κB Signaling Pathway.
| ||
Mol Ther Nucleic Acids Tumor-Derived EV-Encapsulated miR-181b-5p Induces Angiogenesis to Foster Tumorigenesis and Metastasis of ESCC. | ||
Oncotarget PHLPP negatively regulates cell motility through inhibition of Akt activity and integrin expression in pancreatic cancer cells.
|
Reviews
What customers say
The single available review reports a highly positive experience, with the user rating the antibody 5 out of 5 stars. The reviewer used it for Western Blot on SHED patient cell lines and stated that the antibody "worked very well." Overall, the feedback indicates strong performance and satisfaction with the product in this application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Slavica (Verified Customer) (10-04-2021) | The antibody worked very well!
|
