Product Information
27035-1-PBS targets PI3 Kinase p55 Gamma in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25884 Product name: Recombinant human PIK3R3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 312-382 aa of BC021622 Sequence: HLVWLNHKGVRQKRLNVWLGIKNEDAAENYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAFLI Predict reactive species |
| Full Name | phosphoinositide-3-kinase, regulatory subunit 3 (gamma) |
| Calculated Molecular Weight | 85 kDa |
| Observed Molecular Weight | 55 kDa |
| GenBank Accession Number | BC021622 |
| Gene Symbol | PI3 Kinase p55 Gamma |
| Gene ID (NCBI) | 8503 |
| RRID | AB_2880730 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92569 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
PIK3R3, also named as p55PIK, belongs to the PI3K p85 subunit family. It binds to activated (phosphorylated) protein-tyrosine kinases through its SH2 domain and regulates their kinase activity. During INS stimulation, it also binds to IRS-1. It is a component of a heterodimer of p110 (catalytic) and p55 (regulatory) subunits. The antibody is specific to PIK3R3.













