Tested Applications
| Positive WB detected in | MCF-7 cells, HUVEC cells, HEK-293 cells |
| Positive IHC detected in | human kidney tissue, mouse stomach tissue, human stomach cancer tissue, human placenta tissue, mouse kidney tissue, rat testis tissue, mouse testis tissue, rat stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27035-1-AP targets PI3 Kinase p55 Gamma in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25884 Product name: Recombinant human PIK3R3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 312-382 aa of BC021622 Sequence: HLVWLNHKGVRQKRLNVWLGIKNEDAAENYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAFLI Predict reactive species |
| Full Name | phosphoinositide-3-kinase, regulatory subunit 3 (gamma) |
| Calculated Molecular Weight | 85 kDa |
| Observed Molecular Weight | 55 kDa |
| GenBank Accession Number | BC021622 |
| Gene Symbol | PI3 Kinase p55 Gamma |
| Gene ID (NCBI) | 8503 |
| RRID | AB_2880730 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92569 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PIK3R3, also named as p55PIK, belongs to the PI3K p85 subunit family. It binds to activated (phosphorylated) protein-tyrosine kinases through its SH2 domain and regulates their kinase activity. During INS stimulation, it also binds to IRS-1. It is a component of a heterodimer of p110 (catalytic) and p55 (regulatory) subunits. The antibody is specific to PIK3R3.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PI3 Kinase p55 Gamma antibody 27035-1-AP | Download protocol |
| WB protocol for PI3 Kinase p55 Gamma antibody 27035-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PI3 Kinase p55 Gamma Polyclonal antibody (Cat# 27035-1-AP) has 9 total citations. These appear in journals including Scientific Reports, Molecular Oncology, World Journal of Men's Health, Journal of Biological Chemistry, BMC Cancer, BMC Oral Health, American Journal of Physiology, PLoS One, and Frontiers in Molecular Biosciences. Research fields span oncology (lung, colorectal, glioblastoma, Wilms' tumor), PI3K signaling, erectile dysfunction, COPD, chondrogenesis, and ulcerative colitis, using WB and IHC applications.
| Species | Application | Title |
|---|---|---|
Sci Rep Clinical significance and potential molecular mechanisms of SYT15 expression in lung adenocarcinoma. | ||
Mol Oncol Consensus molecular subtyping of colorectal carcinoma brain metastases reveals a metabolic signature associated with poor patient survival | ||
World J Mens Health Relaxin-2 Prevents Erectile Dysfunction by Cavernous Nerve, Endothelial and Histopathological Protection Effects in Rats with Bilateral Cavernous Nerve Injury | ||
J Biol Chem Adenovirus E4ORF1 activates isoform-specific phosphatidylinositol 3-kinase signaling in human endothelial cells. | ||
BMC Cancer Circ_0021350 plays an oncogene role by regulating miR-1207-3p/PIK3R3 in glioblastoma
| ||
BMC Oral Health Lactate inhibits mouse embryonic palatal mesenchyme cells chondrogenesis through AKT-PKM2 axis. |
