Piezo1 (extracellular domain) Polyclonal antibody

• 

  WB analysis of HeLa using 28511-1-AP

  WB result of Piezo1 (extracellular domain) antibody (28511-1-AP; 1:1000; room temperature for 1.5 hours) with wild-type and Piezo1 (extracellular domain) knockout HeLa cells.

• 

  WB analysis using 28511-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28511-1-AP (Piezo1 (extracellular domain) antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 28511-1-AP

  WB result of Piezo1 (extracellular domain) antibody (28511-1-AP; 1:600; room temperature for 1.5 hours) with wild-type and Piezo1 (extracellular domain) knockout Hepa 1-6 cells.

• 

  WB analysis using 28511-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28511-1-AP (Piezo1 (extracellular domain) antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of THP-1 using 28511-1-AP

  Immunofluorescent analysis of THP-1 cells using Piezo1 (extracellular domain) antibody (28511-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

Piezo1 (extracellular domain) Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 28511-1-AP

Publications(34)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

FAM38A, PIEZO1, KIAA0233, Membrane protein induced by beta-amyloid treatment, Piezo-type mechanosensitive ion channel component 1

---

Tested Applications

• Positive WB detected in: HeLa cells, Hepa1-6 cells, HepG2 cells, hTERT-RPE1 cells
• Positive IF/ICC detected in: THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 11 publications below
• WB: See 19 publications below
• IHC: See 5 publications below
• IF: See 18 publications below
• IP: See 1 publications below
• CoIP: See 1 publications below

Product Information

28511-1-AP targets Piezo1 (extracellular domain) in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat, xenopus
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29858

  Product name: Recombinant human FAM38A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 108-294 aa of BC008073

  Sequence: YEELSRQFDPQPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTADITLRFTWNFQRDLAKGGTVEYANEKHMLALAPNSTARRQLASLLEGTSDQSVVIPNLFPKYIRAPNGPEANPVKQLQPNEEADYLGVRIQLRREQGAGATGFLEWWVIELQECRTDCNLLPMVIFSDK

• Full Name: family with sequence similarity 38, member A
• Calculated Molecular Weight: 286 kDa
• Observed Molecular Weight: 280-300 kDa
• GenBank Accession Number: BC008073
• Gene Symbol: Piezo1/FAM38A
• Gene ID (NCBI): 9780
• RRID: AB_2881161
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92508
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mechanotransduction, the conversion of mechanical force into biological signals, is a fundamental physiologic process of mammalian cells which influences many critical processes including embryonic development, tactile, pain, and auditory sensation, regulation of vascular tone, flow sensing in the kidney, and muscle and tendon stretch. FAM38A, also known as PIEZO1, has recently been identified as a mechanotransduction protein that gets involved in mechanosensation and stretch-activated cation channel activation. Fam38A also plays a key role in epithelial cell adhesion by maintaining integrin activation through R-Ras recruitment to the ER. Mutations in gene encoding PIEZO1 are associated with hereditary xerocytosis. Piezo1 also regulates extrusion to maintain homeostatic epithelial cell numbers. This antibody was raised against the extracellular domain of human Piezo1.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Glia; Mechanosensitive channel Piezo1 is an essential regulator in cell cycle progression of optic nerve head astrocytes; Authors - Yue Wan ; KD Validated
human	WB,IP,IF	FASEB J; Mechanical stretch activates piezo1 in caveolae of alveolar type I cells to trigger ATP release and paracrine stimulation of surfactant secretion from alveolar type II cells.; Authors - Kathrin Diem ; KD Validated
human	WB	JCI Insight; Mechanosensitive Piezo1 channels mediate renal fibrosis.; Authors - Xiaoduo Zhao
mouse,human	WB,IHC	Cell Commun Signal; Activation of mechanosensitive ion channel Piezo1 linking metabolic reprogramming and pro-inflammatory responses in hepatocellular carcinoma; Authors - Juanfen Mo ; KD Validated
human	WB	Acta Biomater; PIEZO1-Mediated Mechanotransduction Regulates Collagen Synthesis on Nanostructured 2D and 3D Models of Fibrosis; Authors - Neda Rashidi
rat	IF	Nat Commun; Environmental stiffness regulates neuronal maturation via Piezo1-mediated transthyretin activity.; Authors - Eva Kreysing ; KD Validated