PIGK Polyclonal antibody, PBS Only

• 

  WB analysis of HT-1080 using 15151-1-AP (same clone as 15151-1-PBS)

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 15151-1-AP (PIGK antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15151-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SMMC-7721 using 15151-1-AP (same clone as 15151-1-PBS)

  SMMC-7721 cells were subjected to SDS PAGE followed by western blot with 15151-1-AP (PIGK antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15151-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 15151-1-AP (same clone as 15151-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15151-1-AP (PIGK antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15151-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 15151-1-AP (same clone as 15151-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 15151-1-AP (PIGK antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15151-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 15151-1-AP (same clone as 15151-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 15151-1-AP (PIGK antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15151-1-PBS in a different storage buffer formulation.

PIGK Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15151-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

Phosphatidylinositol-glycan biosynthesis class K protein, hGPI8, GPI-anchor transamidase, GPI8, GPI transamidase

---

Product Information

15151-1-PBS targets PIGK in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3497

  Product name: Recombinant human PIGK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-332 aa of BC026186

  Sequence: MAVTDSLSRAATVLATVLLLSFGSVAASHIEDQAEQFFRSGHTNNWAVLVCTSRFWFNYRHVANTLSVYRSVKRLGIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDDVEVDYRSYEVTVENFLRVLTGGIPPSTPRSKRLLSDDRSNILIYMTGHGGNGFLKFQDSEEITNIELADAFEQMWQKRRYNELLFIIDTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEFLEEINPASQTNMNDLFQVCPKSLCVSTPGHRTDLFQRDPKNVLITDFFGSVRKVEITTETIKLQQDSEIMESRYSS

• Full Name: phosphatidylinositol glycan anchor biosynthesis, class K
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 40-45 kDa
• GenBank Accession Number: BC026186
• Gene Symbol: PIGK
• Gene ID (NCBI): 10026
• RRID: AB_2164682
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92643
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Phosphatidylinositol glycan, class K (PIGK), is a crucial member of the glycosyl-phosphatidylinositol transamidase (GPIT) protein complex that attaches a diverse group of macromolecules to the plasma membrane of eukaryotes. The human PIGK gene is involved in the key step of transferring GPI-anchor to the respective protein molecules in the plasma membrane (PMID: 22824918). Endogenous PIGK has 2 isoforms, 45 kDa and 36 kDa (PMID: 34193731).