PIGK Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PIGK Polyclonal antibody (15151-1-AP)

PIGK Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15151-1-AP Copied!

Publications (11)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, ELISA

Synonyms

Phosphatidylinositol-glycan biosynthesis class K protein, hGPI8, GPI-anchor transamidase, GPI8, GPI transamidase

• 

  WB analysis of HT-1080 using 15151-1-AP

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 15151-1-AP (PIGK antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SMMC-7721 using 15151-1-AP

  SMMC-7721 cells were subjected to SDS PAGE followed by western blot with 15151-1-AP (PIGK antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 15151-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15151-1-AP (PIGK antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 15151-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 15151-1-AP (PIGK antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 15151-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 15151-1-AP (PIGK antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PIGK in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HT-1080 cells, SMMC-7721 cells, HepG2 cells
• Positive IHC detected in: human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15151-1-AP targets PIGK in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3497

  Product name: Recombinant human PIGK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-332 aa of BC026186

  Sequence: MAVTDSLSRAATVLATVLLLSFGSVAASHIEDQAEQFFRSGHTNNWAVLVCTSRFWFNYRHVANTLSVYRSVKRLGIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDDVEVDYRSYEVTVENFLRVLTGGIPPSTPRSKRLLSDDRSNILIYMTGHGGNGFLKFQDSEEITNIELADAFEQMWQKRRYNELLFIIDTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEFLEEINPASQTNMNDLFQVCPKSLCVSTPGHRTDLFQRDPKNVLITDFFGSVRKVEITTETIKLQQDSEIMESRYSS

• Full Name: phosphatidylinositol glycan anchor biosynthesis, class K
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 40-45 kDa
• GenBank Accession Number: BC026186
• Gene Symbol: PIGK
• Gene ID (NCBI): 10026
• RRID: AB_2164682
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92643
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Phosphatidylinositol glycan, class K (PIGK), is a crucial member of the glycosyl-phosphatidylinositol transamidase (GPIT) protein complex that attaches a diverse group of macromolecules to the plasma membrane of eukaryotes. The human PIGK gene is involved in the key step of transferring GPI-anchor to the respective protein molecules in the plasma membrane (PMID: 22824918). Endogenous PIGK has 2 isoforms, 45 kDa and 36 kDa (PMID: 34193731).

Publications

What published studies show

The PIGK Polyclonal antibody (Cat# 15151-1-AP) has accumulated 11 citations across journals including Nature Communications, Journal of Nanobiotechnology, Advanced Science, Oncogene, Journal of Translational Medicine, Apoptosis, Stem Cell Research & Therapy, Biomaterials Advances, Biochemical Pharmacology, Experimental Cell Research, and Briefings in Functional Genomics. The cited studies span diverse research fields including oncology, cardiology, neurology, immunology, infectious disease, respiratory medicine, and extracellular vesicle/migrasome biology.

Automatically generated from the 11 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,rat	WB	Nat Commun; Macrophage lineage cells-derived migrasomes activate complement-dependent blood-brain barrier damage in cerebral amyloid angiopathy mouse model; Authors - Mengyan Hu
mouse, human	WB,FC	J Nanobiotechnology; M1 macrophage-derived migrasomes exacerbate post-myocardial infarction injury via guanylate binding protein 5.; Authors - Qingfu Zhang
human	WB	Adv Sci (Weinh); Bone Marrow Mesenchymal Stem Cell-Derived Dermcidin-Containing Migrasomes enhance LC3-Associated Phagocytosis of Pulmonary Macrophages and Protect against Post-Stroke Pneumonia; Authors - Tiemei Li
human	WB	J Transl Med; Hypoxic migrasomes drive colorectal cancer liver metastasis by mediating CD5L(+) macrophage efferocytosis via NRP2/PROX1 axis.; Authors - Yuqi Luo
human	WB	Oncogene; PinX1 inhibits migrasomes-mediated mitochondrial transfer to confer cisplatin sensitivity in nasopharyngeal carcinoma.; Authors - Juan Zhang
monkey	WB	Apoptosis; Golgi-derived extracellular vesicle production induced by SARS-CoV-2 envelope protein; Authors - Qiguang Li