PIK3AP1 Polyclonal antibody

• 

  WB analysis using 27903-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27903-1-AP (PIK3AP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

PIK3AP1 Polyclonal Antibody for WB, ELISA

Cat No. 27903-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

Human, Rat, Mouse and More (1)

Applications

WB, ELISA

Synonyms

PIK3AP1, RP11 34E5.3

---

Tested Applications

• Positive WB detected in: HT-29 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

27903-1-AP targets PIK3AP1 in WB, ELISA applications and shows reactivity with Human, Rat, Mouse samples.

• Tested Reactivity: Human, Rat, Mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27398

  Product name: Recombinant human PIK3AP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 634-794 aa of BC029917

  Sequence: LNQKKRSESFRFQQENLKRLRDSITRRQREKQKSGKQTDLEITVPIRHSQHLPAKVEFGVYESGPRKSVIPPRTELRRGDWKTDSTSSTASSTSNRSSTRSLLSVSSGMEGDNEDNEVPEVTRSRSPGPPQVDGTPTMSLERPPRVPPRAASQRPPTRETF

• Full Name: phosphoinositide-3-kinase adaptor protein 1
• Calculated Molecular Weight: 90 kDa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC029917
• Gene Symbol: PIK3AP1
• Gene ID (NCBI): 118788
• RRID: AB_3086007
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6ZUJ8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Phosphoinositide-3-kinase adaptor protein 1 (PIK3AP1), also known as B-cell adaptor for PI3K (BCAP), is a specific protein adaptor of B-cells that is expressed in hematopoietic cells. Besides, PIK3AP1 has been implicated in the development of gastric cancer. (PMID: 26121143, 28087538, 31078520)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	EBioMedicine; A miR-567-PIK3AP1-PI3K/AKT-c-Myc feedback loop regulates tumour growth and chemoresistance in gastric cancer.; Authors - Feifei Zhang