Tested Applications
| Positive WB detected in | MCF-7 cells, HUVEC cells, HEK-293 cells |
| Positive IHC detected in | human kidney tissue, mouse testis tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 3 publications below |
| IHC | See 3 publications below |
Product Information
27035-1-AP targets PI3 Kinase p55 Gamma in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25884 Product name: Recombinant human PIK3R3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 312-382 aa of BC021622 Sequence: HLVWLNHKGVRQKRLNVWLGIKNEDAAENYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAFLI Predict reactive species |
| Full Name | phosphoinositide-3-kinase, regulatory subunit 3 (gamma) |
| Calculated Molecular Weight | 85 kDa |
| Observed Molecular Weight | 55 kDa |
| GenBank Accession Number | BC021622 |
| Gene Symbol | PI3 Kinase p55 Gamma |
| Gene ID (NCBI) | 8503 |
| RRID | AB_2880730 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92569 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PIK3R3, also named as p55PIK, belongs to the PI3K p85 subunit family. It binds to activated (phosphorylated) protein-tyrosine kinases through its SH2 domain and regulates their kinase activity. During INS stimulation, it also binds to IRS-1. It is a component of a heterodimer of p110 (catalytic) and p55 (regulatory) subunits. The antibody is specific to PIK3R3.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PI3 Kinase p55 Gamma antibody 27035-1-AP | Download protocol |
| WB protocol for PI3 Kinase p55 Gamma antibody 27035-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Am J Physiol Lung Cell Mol Physiol p55PIK Deficiency and its N-terminal Derivative inhibit Inflammation and Emphysema in COPD mouse model. | ||
BMC Cancer Circ_0021350 plays an oncogene role by regulating miR-1207-3p/PIK3R3 in glioblastoma
| ||
World J Mens Health Relaxin-2 Prevents Erectile Dysfunction by Cavernous Nerve, Endothelial and Histopathological Protection Effects in Rats with Bilateral Cavernous Nerve Injury | ||
Mol Oncol Consensus molecular subtyping of colorectal carcinoma brain metastases reveals a metabolic signature associated with poor patient survival | ||













