Tested Applications
| Positive IP detected in | Raji cells | 
| Positive IHC detected in | mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below | 
Product Information
25865-1-AP targets PIM2 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse | 
| Cited Reactivity | human | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag23130 Product name: Recombinant human PIM2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 240-311 aa of BC018111 Sequence: RDQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKGGPAPLAWSLLP Predict reactive species | 
                                    
| Full Name | pim-2 oncogene | 
| Calculated Molecular Weight | 311 aa, 34 kDa | 
| Observed Molecular Weight | 34 kDa | 
| GenBank Accession Number | BC018111 | 
| Gene Symbol | PIM2 | 
| Gene ID (NCBI) | 11040 | 
| RRID | AB_2880275 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q9P1W9 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
PIM2 was first identified in T and B cell lymphomas in mice and is a member of a serine/threonine kinase family of proto-oncogenes, which also includes PIM1 and PIM3 (PMID:24505470). They share high sequence homology at the amino acid level; PIM1 and PIM2 are 61% identical and PIM1 and PIM3 are 71% identical (PMID:34503111). The PIM2 protein plays an important role in promoting cell survival and preventing apoptosis. PIM2 is mainly expressed in lymphoid and brain tissues. In human cells, the PIM2 kinase has only two isoforms (34 and 41 kDa), but in mice there are there (34, 37, and 40 kDa), and the 34 kDa isoform has been the main focus of many studies because it plays a crucial role in tumor progression (PMID:33854618).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PIM2 antibody 25865-1-AP | Download protocol | 
| IP protocol for PIM2 antibody 25865-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 



