PITPNA Polyclonal antibody, PBS Only

• 

  WB analysis of HEK-293 using 16613-1-AP (same clone as 16613-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 16613-1-AP (PITPNA antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16613-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 16613-1-AP (same clone as 16613-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 16613-1-AP (PITPNA antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16613-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 16613-1-AP (same clone as 16613-1-PBS)

  IP result of anti-PITPNA (IP:16613-1-AP, 4ug; Detection:16613-1-AP 1:500) with HEK-293 cells lysate 1520ug. This data was developed using the same antibody clone with 16613-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 16613-1-AP (same clone as 16613-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung using 16613-1-AP (PITPNA antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 16613-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 16613-1-AP (same clone as 16613-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart using 16613-1-AP (PITPNA antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 16613-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 16613-1-AP (same clone as 16613-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart using 16613-1-AP (PITPNA antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 16613-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 16613-1-AP (same clone as 16613-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 16613-1-AP (PITPNA antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 16613-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 16613-1-AP (same clone as 16613-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 16613-1-AP (PITPNA antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 16613-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 16613-1-AP (same clone as 16613-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung using 16613-1-AP (PITPNA antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 16613-1-PBS in a different storage buffer formulation.

PITPNA Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 16613-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

16613-1-PBS targets PITPNA in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9849

  Product name: Recombinant human PITPNA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-270 aa of BC045108

  Sequence: MVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD

• Full Name: phosphatidylinositol transfer protein, alpha
• Calculated Molecular Weight: 270 aa, 32 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC045108
• Gene Symbol: PITPNA
• Gene ID (NCBI): 5306
• RRID: AB_2299692
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q00169
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.