Tested Applications
| Positive WB detected in | rat brain tissue, HEK-293 cells, mouse brain tissue, rat cerebellum tissue, mouse cerebellum tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67201-1-Ig targets PITX2 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27924 Product name: Recombinant human PITX2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-286 aa of BC013998 Sequence: MNCMKGPLHLEHRAAGTKLSAVSSSSCHHPQPLAMASVLAPGQPRSLDSSKHRLEVHTISDTSSPEAAEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNS Predict reactive species |
| Full Name | paired-like homeodomain 2 |
| Calculated Molecular Weight | 36 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC013998 |
| Gene Symbol | PITX2 |
| Gene ID (NCBI) | 5308 |
| RRID | AB_2882494 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q99697 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PITX2 belongs to the bicoid class of homeodomain transcription factors, which play essential roles in embryonic development. Various PITX2 isoforms are involved in a wide variety of developmental programs, including left-right signaling. It controls cell proliferation in a tissue-specific manner and is involved in morphogenesis. During embryonic development, PITX2 is involved in the expansion of muscle progenitors. In addition, it may play a role in the proper localization of asymmetric organs such as the heart and stomach. PITX2 can be bound by some other proteins, and are part of a much larger atrial transcriptional complex. This antibody specifically recognizes isoform PTX2C.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for PITX2 antibody 67201-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PITX2 Monoclonal antibody (1E3B1), catalog number 67201-1-Ig, has 4 total citations. These appear in Genomics Proteomics Bioinformatics, Oral Diseases, PLoS One, and Aging (Albany NY). The research fields span developmental biology (mouse palate development, myoblast differentiation and pelvic floor muscle development in fetal rats), oral pathology (enamel defects in Axenfeld-Rieger syndrome), and cardiovascular aging (sinoatrial node dysfunction). Applications cited include WB and IF in mouse and rat models.
| Species | Application | Title |
|---|---|---|
Genomics Proteomics Bioinformatics Single-cell Atlas of Developing Mouse Palates Reveals Cellular and Molecular Transitions in Periderm Cell Fate | ||
Oral Dis Enamel defects of Axenfeld-Rieger syndrome and the role of PITX2 in its pathogenesis.
| ||
PLoS One ATRA influences the differentiation and fusion of myoblasts by regulating Rarα/Pitx2, leading to abnormal development of the pelvic floor muscles (PFMs) in fetal rats. | ||
Aging (Albany NY) D-galactose causes sinoatrial node dysfunction: from phenotype to mechanism
|
Reviews
What customers say
The single review for this product reports a 5-star rating from an immunofluorescence application on mouse heart tissue at a 1:200 dilution. The reviewer noted that the antibody worked well for their IF experiment, indicating reliable performance and clear staining in their specific use case. Overall, the feedback is positive, highlighting the product's effectiveness in immunofluorescence on mouse cardiac tissue.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Kenzo (Verified Customer) (03-28-2024) | Worked well for immunofluorescence in mouse heart tissues.
|
