• Featured Product
  • KD/KO Validated

PITX2 Monoclonal antibody, PBS Only

PITX2 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 67201-1-PBS
Clone No.1E3B1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

1E3B1, ALL1-responsive protein ARP1, ARP1, Paired-like homeodomain transcription factor 2, RIEG bicoid-related homeobox transcription factor

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67201-1-PBS targets PITX2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27924

Product name: Recombinant human PITX2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-286 aa of BC013998

Sequence: MNCMKGPLHLEHRAAGTKLSAVSSSSCHHPQPLAMASVLAPGQPRSLDSSKHRLEVHTISDTSSPEAAEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNS

Predict reactive species
Full Name paired-like homeodomain 2
Calculated Molecular Weight 36 kDa
Observed Molecular Weight 30 kDa
GenBank Accession NumberBC013998
Gene Symbol PITX2
Gene ID (NCBI) 5308
RRIDAB_2882494
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ99697
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PITX2 belongs to the bicoid class of homeodomain transcription factors, which play essential roles in embryonic development. Various PITX2 isoforms are involved in a wide variety of developmental programs, including left-right signaling. It controls cell proliferation in a tissue-specific manner and is involved in morphogenesis. During embryonic development, PITX2 is involved in the expansion of muscle progenitors. In addition, it may play a role in the proper localization of asymmetric organs such as the heart and stomach. PITX2 can be bound by some other proteins, and are part of a much larger atrial transcriptional complex. This antibody specifically recognizes isoform PTX2C.

Loading...
||
New chat Able
正在加载,请稍候...