Tested Applications
Positive IHC detected in | human stomach cancer tissue, human gliomas tissue, mouse kidney tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
11942-1-AP targets PKIB in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2541 Product name: Recombinant human PKIB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-78 aa of BC036011 Sequence: MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQLEKPQNEEK Predict reactive species |
Full Name | protein kinase (cAMP-dependent, catalytic) inhibitor beta |
Calculated Molecular Weight | 78 aa, 9 kDa |
GenBank Accession Number | BC036011 |
Gene Symbol | PKIB |
Gene ID (NCBI) | 5570 |
RRID | AB_3085384 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9C010 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The cAMP-dependent protein kinase inhibitor-β (PKIB) is also named as PRKACN2. PKIB is presumed to be one of the regulatory factors controlling the cAMP-dependent protein kinase A signaling pathway (PMID: 23224602). PKIB plays an important role in regulating the proliferation, migration, and even metastasis of osteosarcoma (PMID: 17195088). The expression of PKIB in the cytoplasm of tumor is closely related to pAkt and the triple negative breast cancer (PMID: 28387904).
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for PKIB antibody 11942-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |