PKLR Recombinant monoclonal antibody, PBS Only (Detector)

• 

  WB analysis of HepG2 using 86485-1-RR (same clone as 86485-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 86485-1-RR (PKLR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86485-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 86485-1-RR (same clone as 86485-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 86485-1-RR (PKLR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86485-1-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA sample test of MP02639-1

  The mean PKLR concentration was determined to be 113.54 ng/mL in NIH/3T3 cell extract based on a 1.20 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP02639-1

  Sandwich ELISA standard curve of MP02639-1, Human PKLR Recombinant Matched Antibody Pair - PBS only. 86485-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag17933. 86485-1-PBS was HRP conjugated as the detection antibody. Range: 0.625-40 ng/mL.

• 

  Affinity and Kinetic Characterization of 86485-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86485-1-RR against Human PKLR were performed. The affinity constant is below 1 pM.

PKLR Uni-rAb^® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA

Cat No. 86485-1-PBS

Clone No.251231F12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Sandwich ELISA, Indirect ELISA

Synonyms

EC:2.7.1.40, PK1, PKL, Pyruvate kinase isozymes L/R, Pyruvate kinase PKLR

---

Product Information

86485-1-PBS targets PKLR as part of a matched antibody pair:

MP02639-1: 86485-2-PBS capture and 86485-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag17933

  Product name: Recombinant human PKLR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 446-556 aa of BC025737

  Sequence: PLSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRSAQLLSRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIVVT

• Full Name: pyruvate kinase, liver and RBC
• Calculated Molecular Weight: 574 aa, 62 kDa
• Observed Molecular Weight: 58-62 kDa
• GenBank Accession Number: BC025737
• Gene Symbol: PKLR
• Gene ID (NCBI): 5313
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P30613
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PKLR(Pyruvate kinase isozymes R/L) is also named as PK1,PKL,which is a glycolytic enzyme that catalyzes the transphosphorylation from phosphoenolpyruvate (PEP) to ADP, yielding pyruvate and ATP. It is the last step of the glycolytic pathway and is essentially irreversible.It belongs to the pyruvate kinase family and There are 4 isozymes of pyruvate kinase in mammals: L, R, M1 and M2. L type is major isozyme in the liver, R is found in red cells, M1 is the main form in muscle, heart and brain, and M2 is found in early fetal tissues.Defects in PKLR are the cause of pyruvate kinase hyperactivity (PKHYP) and pyruvate kinase deficiency of red cells (PKRD).It can form a homotetramer(PMID:11960989).