PKLR Recombinant monoclonal antibody, PBS Only (Detector)

PKLR Uni-rAb® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA
Cat No. 86485-1-PBS
Clone No.251231F12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Sandwich ELISA, Indirect ELISA

EC:2.7.1.40, PK1, PKL, Pyruvate kinase isozymes L/R, Pyruvate kinase PKLR

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86485-1-PBS targets PKLR as part of a matched antibody pair:

MP02639-1: 86485-2-PBS capture and 86485-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag17933

Product name: Recombinant human PKLR protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 446-556 aa of BC025737

Sequence: PLSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRSAQLLSRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIVVT

Predict reactive species
Full Name pyruvate kinase, liver and RBC
Calculated Molecular Weight 574 aa, 62 kDa
Observed Molecular Weight 58-62 kDa
GenBank Accession NumberBC025737
Gene Symbol PKLR
Gene ID (NCBI) 5313
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP30613
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PKLR(Pyruvate kinase isozymes R/L) is also named as PK1,PKL,which is a glycolytic enzyme that catalyzes the transphosphorylation from phosphoenolpyruvate (PEP) to ADP, yielding pyruvate and ATP. It is the last step of the glycolytic pathway and is essentially irreversible.It belongs to the pyruvate kinase family and There are 4 isozymes of pyruvate kinase in mammals: L, R, M1 and M2. L type is major isozyme in the liver, R is found in red cells, M1 is the main form in muscle, heart and brain, and M2 is found in early fetal tissues.Defects in PKLR are the cause of pyruvate kinase hyperactivity (PKHYP) and pyruvate kinase deficiency of red cells (PKRD).It can form a homotetramer(PMID:11960989).

Loading...
||
New chat

Able

正在加载,请稍候...