PKLR Recombinant monoclonal antibody

• 

  WB analysis of HepG2 using 86485-1-RR

  HepG2 cells were subjected to SDS PAGE followed by western blot with 86485-1-RR (PKLR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 86485-1-RR

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 86485-1-RR (PKLR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 86485-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86485-1-RR against Human PKLR were performed. The affinity constant is below 1 pM.

PKLR Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86485-1-RR

Clone No.251231F12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

EC:2.7.1.40, PK1, PKL, Pyruvate kinase isozymes L/R, Pyruvate kinase PKLR

---

Tested Applications

• Positive WB detected in: HepG2 cells, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86485-1-RR targets PKLR in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag17933

  Product name: Recombinant human PKLR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 446-556 aa of BC025737

  Sequence: PLSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRSAQLLSRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIVVT

• Full Name: pyruvate kinase, liver and RBC
• Calculated Molecular Weight: 574 aa, 62 kDa
• Observed Molecular Weight: 58-62 kDa
• GenBank Accession Number: BC025737
• Gene Symbol: PKLR
• Gene ID (NCBI): 5313
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P30613
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PKLR(Pyruvate kinase isozymes R/L) is also named as PK1,PKL,which is a glycolytic enzyme that catalyzes the transphosphorylation from phosphoenolpyruvate (PEP) to ADP, yielding pyruvate and ATP. It is the last step of the glycolytic pathway and is essentially irreversible.It belongs to the pyruvate kinase family and There are 4 isozymes of pyruvate kinase in mammals: L, R, M1 and M2. L type is major isozyme in the liver, R is found in red cells, M1 is the main form in muscle, heart and brain, and M2 is found in early fetal tissues.Defects in PKLR are the cause of pyruvate kinase hyperactivity (PKHYP) and pyruvate kinase deficiency of red cells (PKRD).It can form a homotetramer(PMID:11960989).