PKNOX2 Polyclonal antibody

• 

  WB analysis of RAW264.7 using 20352-1-AP

  RAW264.7 cells were subjected to SDS PAGE followed by western blot with 20352-1-AP (PKNOX2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 20352-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 20352-1-AP (PKNOX2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 20352-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 20352-1-AP (PKNOX2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human skeletal muscle using 20352-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 20352-1-AP (PKNOX2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 20352-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 20352-1-AP (PKNOX2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 20352-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 20352-1-AP (PKNOX2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human kidney using 20352-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 20352-1-AP (PKNOX2 antibody) at dilution of 1:50 (under 40x lens).

PKNOX2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 20352-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, RIP, ELISA

Synonyms

Homeobox protein PREP-2, PREP2

---

Tested Applications

• Positive WB detected in: RAW 264.7 cells, HeLa cells, human skeletal muscle tissue, mouse brain tissue, mouse lung tissue
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IF: See 1 publications below
• RIP: See 1 publications below

Product Information

20352-1-AP targets PKNOX2 in WB, IHC, IF, RIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14195

  Product name: Recombinant human PKNOX2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 350-471 aa of BC045626

  Sequence: MLDASNPDPAPKAKKIKSQHRPTQRFWPNSIAAGVLQQQGGAPGTNPDGSINLDNLQSLSSDSATMAMQQAMMAAHDDSLDGTEEEDEDEMEEEEEELEEEVDELQTTNVSDLGLEHSDSLE

• Full Name: PBX/knotted 1 homeobox 2
• Calculated Molecular Weight: 472 aa, 52 kDa
• Observed Molecular Weight: 70 kDa, 55 kDa
• GenBank Accession Number: BC045626
• Gene Symbol: PKNOX2
• Gene ID (NCBI): 63876
• RRID: AB_10694277
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96KN3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PKNOX2, PBX/knotted 1 homeobox 2, also named as PREP2, belongs to the three-amino acid loop extension (TALE) homeobox family. As it contains a DNA-binding motif, PKNOX2 may function as a nuclear transcription factor, experiments have reported the PKNOX2 protein locates to the nucleus. It was showed that highest expression of a 4-kb PREP2 (PKNOX2) transcript in heart, brain, skeletal muscle, and ovary(PMID:11972344). Several years later, PKNOX2 was identified as one of the cis-regulated genes for alcohol addiction in mice, however it has not been reported to be associated with any similar phenotype in humans to date (PMID:19721000). The molecular weight of the protein may differ from the theoretical value.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Biochem Biophys Res Commun; PKNOX2 regulates myofibroblast functions and tubular cell survival during kidney fibrosis.; Authors - Yoshiaki Miyake
mouse	WB	Br J Cancer; Impact of gut microbiome on radiotherapy and immunotherapy efficacy in microsatellite-stable colorectal cancer: role of propionic acid and B. fragilis; Authors - Lu Yu
pig	WB,RIP	Int J Mol Sci; LncRNA TCONS_00323213 Promotes Myogenic Differentiation by Interacting with PKNOX2 to Upregulate MyoG in Porcine Satellite Cells; Authors - Mengxun Li