Tested Applications
| Positive WB detected in | RAW 264.7 cells, HeLa cells, human skeletal muscle tissue, mouse brain tissue, mouse lung tissue |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IF | See 1 publications below |
| RIP | See 1 publications below |
Product Information
20352-1-AP targets PKNOX2 in WB, IHC, IF, RIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | mouse, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14195 Product name: Recombinant human PKNOX2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 350-471 aa of BC045626 Sequence: MLDASNPDPAPKAKKIKSQHRPTQRFWPNSIAAGVLQQQGGAPGTNPDGSINLDNLQSLSSDSATMAMQQAMMAAHDDSLDGTEEEDEDEMEEEEEELEEEVDELQTTNVSDLGLEHSDSLE Predict reactive species |
| Full Name | PBX/knotted 1 homeobox 2 |
| Calculated Molecular Weight | 472 aa, 52 kDa |
| Observed Molecular Weight | 70 kDa, 55 kDa |
| GenBank Accession Number | BC045626 |
| Gene Symbol | PKNOX2 |
| Gene ID (NCBI) | 63876 |
| RRID | AB_10694277 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96KN3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PKNOX2, PBX/knotted 1 homeobox 2, also named as PREP2, belongs to the three-amino acid loop extension (TALE) homeobox family. As it contains a DNA-binding motif, PKNOX2 may function as a nuclear transcription factor, experiments have reported the PKNOX2 protein locates to the nucleus. It was showed that highest expression of a 4-kb PREP2 (PKNOX2) transcript in heart, brain, skeletal muscle, and ovary(PMID:11972344). Several years later, PKNOX2 was identified as one of the cis-regulated genes for alcohol addiction in mice, however it has not been reported to be associated with any similar phenotype in humans to date (PMID:19721000). The molecular weight of the protein may differ from the theoretical value.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PKNOX2 antibody 20352-1-AP | Download protocol |
| WB protocol for PKNOX2 antibody 20352-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Biochem Biophys Res Commun PKNOX2 regulates myofibroblast functions and tubular cell survival during kidney fibrosis. | ||
Int J Mol Sci LncRNA TCONS_00323213 Promotes Myogenic Differentiation by Interacting with PKNOX2 to Upregulate MyoG in Porcine Satellite Cells |













