PLA2G1B Polyclonal antibody, PBS Only

• 

  WB analysis using 15843-1-AP (same clone as 15843-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15843-1-AP (PLA2G1B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15843-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 15843-1-AP (same clone as 15843-1-PBS)

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 15843-1-AP (PLA2G1B antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15843-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse spleen using 15843-1-AP (same clone as 15843-1-PBS)

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 15843-1-AP (PLA2G1B Antibody) at dilution of 1:300 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 15843-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 15843-1-AP (same clone as 15843-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 15843-1-AP (PLA2G1B antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15843-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 15843-1-AP (same clone as 15843-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 15843-1-AP (PLA2G1B antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15843-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse pancreas using 15843-1-AP (same clone as 15843-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse pancreas tissue using PLA2G1B antibody (15843-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15843-1-PBS in a different storage buffer formulation.

PLA2G1B Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 15843-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

PLA2, Phosphatidylcholine 2-acylhydrolase 1B, EC:3.1.1.4

---

Product Information

15843-1-PBS targets PLA2G1B in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8603

  Product name: Recombinant human PLA2G1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-70 aa of BC005386

  Sequence: MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKQKQRV

• Full Name: phospholipase A2, group IB (pancreas)
• Calculated Molecular Weight: 70aa,8 kDa; 148aa,16 kDa
• Observed Molecular Weight: 13-16 kDa
• GenBank Accession Number: BC005386
• Gene Symbol: PLA2G1B
• Gene ID (NCBI): 5319
• RRID: AB_2878190
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P04054
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PLA2G1B is a secreted member of the phospholipase A2 (PLA2) class of enzymes, which is produced by the pancreatic acinar cells. PLA2G1B catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to release arachidonic acid (AA) and lysophospholipids.