Tested Applications
| Positive WB detected in | mouse pancreas tissue, mouse spleen tissue, rat pancreas tissue, pig pancreas tissue |
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse pancreas tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15843-1-AP targets PLA2G1B in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8603 Product name: Recombinant human PLA2G1B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC005386 Sequence: MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKQKQRV Predict reactive species |
| Full Name | phospholipase A2, group IB (pancreas) |
| Calculated Molecular Weight | 70aa,8 kDa; 148aa,16 kDa |
| Observed Molecular Weight | 13-16 kDa |
| GenBank Accession Number | BC005386 |
| Gene Symbol | PLA2G1B |
| Gene ID (NCBI) | 5319 |
| RRID | AB_2878190 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P04054 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PLA2G1B is a secreted member of the phospholipase A2 (PLA2) class of enzymes, which is produced by the pancreatic acinar cells. PLA2G1B catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to release arachidonic acid (AA) and lysophospholipids.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PLA2G1B antibody 15843-1-AP | Download protocol |
| IHC protocol for PLA2G1B antibody 15843-1-AP | Download protocol |
| WB protocol for PLA2G1B antibody 15843-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The 15843-1-AP PLA2G1B Polyclonal antibody has 5 total citations. These appear in Cell Reports in Medicine, Food Chemistry, Frontiers in Immunology, Biology Direct, and Scientific Reports. The associated research fields span cardiovascular disease (heart failure), lipid metabolism and cognition, chronic obstructive pulmonary disease (COPD), renal lipidomic/metabolic remodeling, and non-alcoholic fatty liver disease (NAFLD). Applications cited include Western blot, immunohistochemistry, and immunofluorescence, primarily in mouse and human samples.
| Species | Application | Title |
|---|---|---|
Food Chem Dietary sn-2 palmitate influences cognitive behavior by increasing the transport of liver-produced lysophosphatidylcholine VLCPUFAs to the brain | ||
Front Immunol Integrating bioinformatics and molecular experiments to reveal the critical role of the cellular energy metabolism-related marker PLA2G1B in COPD epithelial cells.
| ||
Biol Direct Dapagliflozin induces renal lipidomic remodeling and systemic metabolic improvement. | ||
Sci Rep Identification and verification of biomarkers associated with arachidonic acid metabolism in non-alcoholic fatty liver disease |
