PLA2G1B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PLA2G1B Polyclonal antibody (15843-1-AP)

PLA2G1B Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 15843-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, ELISA

Synonyms

PLA2, Phosphatidylcholine 2-acylhydrolase 1B, EC:3.1.1.4

• 

  WB analysis using 15843-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15843-1-AP (PLA2G1B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 15843-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 15843-1-AP (PLA2G1B antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse spleen using 15843-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 15843-1-AP (PLA2G1B Antibody) at dilution of 1:300 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 15843-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 15843-1-AP (PLA2G1B antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 15843-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 15843-1-AP (PLA2G1B antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse pancreas using 15843-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse pancreas tissue using PLA2G1B antibody (15843-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse pancreas tissue, mouse spleen tissue, rat pancreas tissue, pig pancreas tissue
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse pancreas tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15843-1-AP targets PLA2G1B in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8603

  Product name: Recombinant human PLA2G1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-70 aa of BC005386

  Sequence: MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKQKQRV

• Full Name: phospholipase A2, group IB (pancreas)
• Calculated Molecular Weight: 70aa,8 kDa; 148aa,16 kDa
• Observed Molecular Weight: 13-16 kDa
• GenBank Accession Number: BC005386
• Gene Symbol: PLA2G1B
• Gene ID (NCBI): 5319
• RRID: AB_2878190
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P04054
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PLA2G1B is a secreted member of the phospholipase A2 (PLA2) class of enzymes, which is produced by the pancreatic acinar cells. PLA2G1B catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to release arachidonic acid (AA) and lysophospholipids.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Sci Rep; Identification and verification of biomarkers associated with arachidonic acid metabolism in non-alcoholic fatty liver disease; Authors - Jia Li
mouse, human	WB,IHC	Front Immunol; Integrating bioinformatics and molecular experiments to reveal the critical role of the cellular energy metabolism-related marker PLA2G1B in COPD epithelial cells.; Authors - Jun Shi ; KD Validated
mouse	WB,IF	Biol Direct; Dapagliflozin induces renal lipidomic remodeling and systemic metabolic improvement.; Authors - Anni Li
mouse	WB	Cell Rep Med; Visceral fat lipolysis by pancreatic lipases worsens heart failure; Authors - Nabil Smichi
mouse	WB	Food Chem; Dietary sn-2 palmitate influences cognitive behavior by increasing the transport of liver-produced lysophosphatidylcholine VLCPUFAs to the brain; Authors - Teng Wei