Product Information
17459-1-AP targets PLA2G2D in ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11099 Product name: Recombinant human PLA2G2D protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 23-145 aa of BC025706 Sequence: LNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC Predict reactive species |
| Full Name | phospholipase A2, group IID |
| Calculated Molecular Weight | 145 aa, 17 kDa |
| GenBank Accession Number | BC025706 |
| Gene Symbol | PLA2G2D |
| Gene ID (NCBI) | 26279 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UNK4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
