PLAG1 Polyclonal antibody

• 

  WB analysis of A431 using 18018-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 18018-1-AP (PLAG1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 18018-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 18018-1-AP (PLAG1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 18018-1-AP

  IP result of anti-PLAG1 (IP:18018-1-AP, 4ug; Detection:18018-1-AP 1:300) with HepG2 cells lysate 2400ug.

• 

  IF Staining of HepG2 using 18018-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HepG2 cells using 18018-1-AP (PLAG1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

PLAG1 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 18018-1-AP

Publications(1)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, ELISA

Synonyms

Zinc finger protein PLAG1, SGPA, PSA, pleiomorphic adenoma gene 1

---

Tested Applications

• Positive WB detected in: A431 cells, HepG2 cells
• Positive IP detected in: HepG2 cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

18018-1-AP targets PLAG1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12566

  Product name: Recombinant human PLAG1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 151-500 aa of BC075047

  Sequence: TCKVCLQTFESTGVLLEHLKSHAGKSSGGVKEKKHQCEHCDRRFYTRKDVRRHMVVHTGRKDFLCQYCAQRFGRKDHLTRHMKKSHNQELLKVKTEPVDFLDPFTCNVSVPIKDELLPVMSLPSSELLSKPFTNTLQLNLYNTPFQSMQSSGSAHQMITTLPLGMTCPIDMDTVHPSHHLSFKYPFSSTSYAISIPEKEQPLKGEIESYLMELQGGVPSSSQDSQASSSSKLGLDPQIGSLDDGAGDLSLSKSSISISDPLNTPALDFSQLFNFIPLNGPPYNPLSVGSLGMSYSQEEAHSSVSQLPPQTQDLQDPANTIGLGSLHSLSAAFTSSLSTSTTLPRFHQAFQ

• Full Name: pleiomorphic adenoma gene 1
• Calculated Molecular Weight: 500 aa, 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC075047
• Gene Symbol: PLAG1
• Gene ID (NCBI): 5324
• RRID: AB_2878482
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6DJT9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Neurooncol Adv; A Cre-mediated copy number variant compromises the reliability of a LoxP-STOP-LoxP-PLAG1 driven brain tumor model.; Authors - Jan Vaillant

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Aqib (Verified Customer) (03-27-2025)

its fairly alright, may be need more washing steps for clean results

• Applications: Western Blot