Phospholipase C Beta 1 Polyclonal antibody

• 

  WB analysis of mouse brain using 26551-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 26551-1-AP (Phospholipase C beta 1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 26551-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 26551-1-AP (Phospholipase C beta 1 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human gliomas using 26551-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 26551-1-AP (Phospholipase C beta 1 antibody at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human gliomas using 26551-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 26551-1-AP (Phospholipase C beta 1 antibody at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human breast cancer using 26551-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 26551-1-AP (Phospholipase C beta 1 antibody at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human breast cancer using 26551-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 26551-1-AP (Phospholipase C beta 1 antibody at dilution of 1:200 (under 40x lens).

• Featured Product
• KD/KO Validated

Phospholipase C Beta 1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26551-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, rat, mouse and More (1)

Applications

WB, IHC, RIP, ELISA

Synonyms

KIAA0581, Phospholipase C beta 1, Phospholipase C I, PI PLC, PLC 154, PLC beta 1, PLC I, PLC154, PLCB1

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: human gliomas tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 6 publications below
• IHC: See 2 publications below
• RIP: See 1 publications below

Product Information

26551-1-AP targets Phospholipase C Beta 1 in WB, IHC, RIP, ELISA applications and shows reactivity with human, rat, mouse samples.

• Tested Reactivity: human, rat, mouse
• Cited Reactivity: human, rat, sheep
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24750

  Product name: Recombinant human PLCB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1162-1216 aa of BC069420

  Sequence: LEFVQEAMKGKISEDSNHGSAPLSLSSDPGKVNHKTPSSEELGGDIPGKEFDTPL

• Full Name: phospholipase C, beta 1 (phosphoinositide-specific)
• Calculated Molecular Weight: 1216 aa, 139 kDa
• Observed Molecular Weight: 139 kDa
• GenBank Accession Number: BC069420
• Gene Symbol: PLCB1
• Gene ID (NCBI): 23236
• RRID: AB_2861360
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NQ66
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PLCB1 catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of many extracellular signals. PLCB1 is activated by two G-protein alpha subunits, alpha-q and alpha-11.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Biochem Genet; PLCB1 Enhances Cell Migration and Invasion in Gastric Cancer Via Regulating Actin Cytoskeletal Remodeling and Epithelial-Mesenchymal Transition; Authors - Yulin Wang ; KD Validated
human	WB	Front Endocrinol (Lausanne); Estrogen receptor subtype mediated anti-inflammation and vasorelaxation via genomic and nongenomic actions in septic mice; Authors - Luyun Zhang
human	WB,IHC	Nat Chem Biol; ENO1 promotes liver carcinogenesis through YAP1-dependent arachidonic acid metabolism; Authors - Linchong Sun ; KD Validated
sheep	WB	Int J Mol Sci; Elucidating the Role of circTIAM1 in Guangling Large-Tailed Sheep Adipocyte Proliferation and Differentiation via the miR-485-3p/PLCB1 Pathway; Authors - Yu Liang
human	WB,RIP	Thorac Cancer; LncRNA AC100826.1 regulated PLCB1 to promote progression in non-small cell lung cancer; Authors - Shenhui Dai
rat,human	WB,IHC	J Ethnopharmacol; Dan-Shen-Yin against ethanol-induced chronic gastric mucosal injury in rats by inhibiting apoptosis via IP3R-controlled calcium release; Authors - Zhirong Zhou