• Featured Product
  • KD/KO Validated

Phospholipase C Beta 1 Polyclonal antibody

Phospholipase C Beta 1 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 26551-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, rat, mouse and More (1)

Applications

WB, IHC, RIP, ELISA

KIAA0581, Phospholipase C beta 1, Phospholipase C I, PI PLC, PLC 154, PLC beta 1, PLC I, PLC154, PLCB1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, rat brain tissue
Positive IHC detected inhuman gliomas tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26551-1-AP targets Phospholipase C Beta 1 in WB, IHC, RIP, ELISA applications and shows reactivity with human, rat, mouse samples.

Tested Reactivity human, rat, mouse
Cited Reactivityhuman, rat, sheep
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag24750

Product name: Recombinant human PLCB1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1162-1216 aa of BC069420

Sequence: LEFVQEAMKGKISEDSNHGSAPLSLSSDPGKVNHKTPSSEELGGDIPGKEFDTPL

Predict reactive species
Full Name phospholipase C, beta 1 (phosphoinositide-specific)
Calculated Molecular Weight 1216 aa, 139 kDa
Observed Molecular Weight 139 kDa
GenBank Accession NumberBC069420
Gene Symbol PLCB1
Gene ID (NCBI) 23236
RRIDAB_2861360
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NQ66
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PLCB1 catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of many extracellular signals. PLCB1 is activated by two G-protein alpha subunits, alpha-q and alpha-11.

Protocols

Product Specific Protocols
IHC protocol for Phospholipase C Beta 1 antibody 26551-1-APDownload protocol
WB protocol for Phospholipase C Beta 1 antibody 26551-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Biochem Genet

PLCB1 Enhances Cell Migration and Invasion in Gastric Cancer Via Regulating Actin Cytoskeletal Remodeling and Epithelial-Mesenchymal Transition

Authors - Yulin Wang
  • KD Validated
humanWB

Front Endocrinol (Lausanne)

Estrogen receptor subtype mediated anti-inflammation and vasorelaxation via genomic and nongenomic actions in septic mice

Authors - Luyun Zhang
humanWB,IHC

Nat Chem Biol

ENO1 promotes liver carcinogenesis through YAP1-dependent arachidonic acid metabolism

Authors - Linchong Sun
  • KD Validated
sheepWB

Int J Mol Sci

Elucidating the Role of circTIAM1 in Guangling Large-Tailed Sheep Adipocyte Proliferation and Differentiation via the miR-485-3p/PLCB1 Pathway

Authors - Yu Liang
humanWB,RIP

Thorac Cancer

LncRNA AC100826.1 regulated PLCB1 to promote progression in non-small cell lung cancer

Authors - Shenhui Dai
rat,humanWB,IHC

J Ethnopharmacol

Dan-Shen-Yin against ethanol-induced chronic gastric mucosal injury in rats by inhibiting apoptosis via IP3R-controlled calcium release

Authors - Zhirong Zhou
Loading...
||
New chat Able
正在加载,请稍候...