PLN Recombinant monoclonal antibody

• 

  WB analysis using 86080-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86080-1-RR (PLN antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 86080-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86080-1-RR against Human PLN were performed. The affinity constant is below 1 pM.

PLN Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86080-1-RR

Clone No.250753E7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

CMD1P, PLB

---

Tested Applications

• Positive WB detected in: mouse heart tissue, rat heart tissue, human heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86080-1-RR targets PLN in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8632

  Product name: Recombinant human PLN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-52 aa of BC005269

  Sequence: MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL

• Full Name: phospholamban
• Calculated Molecular Weight: 52 aa, 6 kDa
• Observed Molecular Weight: 10 kDa, 25 kDa
• GenBank Accession Number: BC005269
• Gene Symbol: PLN
• Gene ID (NCBI): 5350
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P26678
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Phospholamban (PLN) is a 52-amino-acid transmembrane protein found in the sarcoplasmic reticulum (SR) of cardiac muscle cells. It has been postulated to regulate the activity of the calcium pump of cardiac sarcoplasmic reticulum. Phospholamban has a homopentamer form(25-27 kDa).