Tested Applications
| Positive WB detected in | Fibroblasts cells, Mouse Fibroblast cells |
| Positive IHC detected in | human skin cancer tissue, Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
12475-1-AP targets PLOD1 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse, Bumblebees |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3103 Product name: Recombinant human PLOD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 378-728 aa of BC016657 Sequence: YFSVDADVALTEPNSLRLLIQQNKNVIAPLMTRHGRLWSNFWGALSADGYYARSEDYVDIVQGRRVGVWNVPYISNIYLIKGSALRGELQSSDLFHHSKLDPDMAFCANIRQQDVFMFLTNRHTLGHLLSLDSYRTTHLHNDLWEVFSNPEDWKEKYIHQNYTKALAGKLVETPCPDVYWFPIFTEVACDELVEEMEHFGQWSLGNNKDNRIQGGYENVPTIDIHMNQIGFEREWHKFLLEYIAPMTEKLYPGYYTRAQFDLAFVVRYKPDEQPSLMPHHDASTFTINIALNRVGVDYEGGGCRFLRYNCSIRAPRKGWTLMHPGRLTHYHEGLPTTRGTRYIAVSFVDP Predict reactive species |
| Full Name | procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase 1 |
| Calculated Molecular Weight | 727 aa, 84 kDa |
| Observed Molecular Weight | 85-88 kDa |
| GenBank Accession Number | BC016657 |
| Gene Symbol | PLOD1 |
| Gene ID (NCBI) | 5351 |
| RRID | AB_2877860 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q02809 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PLOD1, also named as LLH, PLOD and LH1, forms hydroxylysine residues in -Xaa-Lys-Gly- sequences in collagens. These hydroxylysines serve as sites of attachment for carbohydrate units and are essential for the stability of the intermolecular collagen cross-links. PLOD1 catalyses the hydroxylation of lysine residues during the posttranslational modification of type I collagen, the major protein of bone.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PLOD1 antibody 12475-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
PLoS Genet Cyclophilin B control of lysine post-translational modifications of skin type I collagen. | ||
Bone Decrease of lysyl hydroxylase 2 activity causes abnormal collagen molecular phenotypes, defective mineralization and compromised mechanical properties of bone. | ||
Sci Rep Lysyl hydroxylase 2 mediated collagen post-translational modifications and functional outcomes | ||
J Pharmacol Exp Ther Minoxidil Cannot Be Used To Target Lysyl Hydroxylases during Postnatal Mouse Lung Development: A Cautionary Note. | ||
Front Genet Mating Stimulates the Immune Response and Sperm Storage-Related Genes Expression in Spermathecae of Bumblebee (Bombus terrestris) Queen. |

















