PLOD1 Polyclonal antibody

• 

  WB analysis using 29480-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 29480-1-AP (PLOD1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 29480-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29480-1-AP (PLOD1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 29480-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 29480-1-AP (PLOD1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human skin cancer using 29480-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 29480-1-AP (PLOD1 antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human skin cancer using 29480-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 29480-1-AP (PLOD1 antibody) at dilution of 1:200 (under 10x lens).

• 

  IF Staining of K-562 using 29480-1-AP

  Immunofluorescent analysis of (4% PFA) fixed K-562 cells using PLOD1 antibody (29480-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

PLOD1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 29480-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

FLJ42041, LH, LH1, LLH, Lysyl hydroxylase 1, PLOD, PLOD1

---

Tested Applications

• Positive WB detected in: A375 cells, K-562 cells, HeLa cells, U-251 cells, U2OS cells
• Positive IHC detected in: human skin cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

29480-1-AP targets PLOD1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31626

  Product name: Recombinant human PLOD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 450-564 aa of BC016657

  Sequence: YISNIYLIKGSALRGELQSSDLFHHSKLDPDMAFCANIRQQDVFMFLTNRHTLGHLLSLDSYRTTHLHNDLWEVFSNPEDWKEKYIHQNYTKALAGKLVETPCPDVYWFPIFTEV

• Full Name: procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase 1
• Calculated Molecular Weight: 727 aa, 84 kDa
• Observed Molecular Weight: 84-88 kDa
• GenBank Accession Number: BC016657
• Gene Symbol: PLOD1
• Gene ID (NCBI): 5351
• RRID: AB_2918315
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q02809
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PLOD1, as known as procollagen‐lysine, 2‐oxoglutarate 5‐dioxygenase 1, is a member of the PLOD family(Uniprot, GeneID:5351). PLOD1 participates in catalyzing hydroxylysine residue, which is critical for the formation of covalent cross-link (PMID:30003082). PLOD1 plays an important role in the development and progression of tumors. Aberrantly expressed PLOD1 promotes cancer aggressiveness in glioma and bladder cancer, providing a potential prognostic biomarker and therapeutic target (PMID:31199049, PMID:34040895). PLOD1 has 2 isoforms produced by alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Oncogene; MUC1-C auto-regulatory complex with EBNA1 is responsible for latent Epstein-Barr virus-associated gastric cancer progression; Authors - Hiroki Ozawa
human	IHC	Aging (Albany NY); Systematic characterization of the expression, prognosis and immune characteristics of PLOD family genes in breast cancer; Authors - Dan-Dan Wang
human	WB,IF	Phytomedicine; Gluconic acid alleviates hypertrophic scar formation through binding PLOD1, reducing p-AKT signaling and activating autophagy; Authors - Jingyun Li