PLOD1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PLOD1 Polyclonal antibody (29480-1-AP)

PLOD1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 29480-1-AP Copied!

Publications (8)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (1)

Applications

WB, IHC, IF/ICC, CoIP, ELISA

Synonyms

FLJ42041, LH, LH1, LLH, Lysyl hydroxylase 1, PLOD, PLOD1

• 

  WB analysis using 29480-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 29480-1-AP (PLOD1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 29480-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29480-1-AP (PLOD1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 29480-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 29480-1-AP (PLOD1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 29480-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 29480-1-AP (PLOD1 antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 29480-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 29480-1-AP (PLOD1 antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of K-562 using 29480-1-AP

  Immunofluorescent analysis of (4% PFA) fixed K-562 cells using PLOD1 antibody (29480-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PLOD1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A375 cells, K-562 cells, HeLa cells, U-251 cells, U2OS cells
• Positive IHC detected in: human skin cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29480-1-AP targets PLOD1 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31626

  Product name: Recombinant human PLOD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 450-564 aa of BC016657

  Sequence: YISNIYLIKGSALRGELQSSDLFHHSKLDPDMAFCANIRQQDVFMFLTNRHTLGHLLSLDSYRTTHLHNDLWEVFSNPEDWKEKYIHQNYTKALAGKLVETPCPDVYWFPIFTEV

• Full Name: procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase 1
• Calculated Molecular Weight: 727 aa, 84 kDa
• Observed Molecular Weight: 84-88 kDa
• GenBank Accession Number: BC016657
• Gene Symbol: PLOD1
• Gene ID (NCBI): 5351
• RRID: AB_2918315
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q02809
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PLOD1, as known as procollagen‐lysine, 2‐oxoglutarate 5‐dioxygenase 1, is a member of the PLOD family(Uniprot, GeneID:5351). PLOD1 participates in catalyzing hydroxylysine residue, which is critical for the formation of covalent cross-link (PMID:30003082). PLOD1 plays an important role in the development and progression of tumors. Aberrantly expressed PLOD1 promotes cancer aggressiveness in glioma and bladder cancer, providing a potential prognostic biomarker and therapeutic target (PMID:31199049, PMID:34040895). PLOD1 has 2 isoforms produced by alternative splicing.

Publications

What published studies show

The anti-PLOD1 antibody (Cat# 29480-1-AP) has 8 total citations. These appear in journals including Acta Pharm Sin B, Phytomedicine, Oncogene, Frontiers in Immunology, Frontiers in Oncology, PeerJ, Discover Oncology, and Aging. The research fields span multiple cancer types—head and neck squamous cell carcinoma, gastric cancer, colorectal cancer, renal cell carcinoma, and breast cancer—covering topics such as metabolic-epigenetic reprogramming, immune microenvironment, extracellular matrix remodeling, endoplasmic reticulum stress, and prognostic biomarker analysis.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC,CoIP	Acta Pharm Sin B; Metabolic-epigenetic reprogramming via the PLOD1-PFKP axis drives cisplatin resistance in HNSCC.; Authors - Xinyuan Zhao ; KO Validated
human	WB,IF	Phytomedicine; Gluconic acid alleviates hypertrophic scar formation through binding PLOD1, reducing p-AKT signaling and activating autophagy; Authors - Jingyun Li
human	WB	Oncogene; MUC1-C auto-regulatory complex with EBNA1 is responsible for latent Epstein-Barr virus-associated gastric cancer progression; Authors - Hiroki Ozawa
human	WB,IHC	Front Immunol; Mass spectrometry-based multi-omics analysis elucidates immune microenvironmental characteristics and the risk of distant metastasis in N1c colorectal cancer.; Authors - Baiwang Zhu ; KD Validated
human	WB	Front Oncol; Prognostic biomarker and clinical significance of PLOD gene family in clear cell renal cell carcinoma.; Authors - Xuan Shang
human	IHC	PeerJ; Multi-omics evidence reveals a causal role of endoplasmic reticulum stress in cancer development.; Authors - Rui Guo