Tested Applications
Positive WB detected in | A375 cells, K-562 cells, HeLa cells, U-251 cells, U2OS cells |
Positive IHC detected in | human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | K-562 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:6000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IHC | See 1 publications below |
IF | See 1 publications below |
Product Information
29480-1-AP targets PLOD1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag31626 Product name: Recombinant human PLOD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 450-564 aa of BC016657 Sequence: YISNIYLIKGSALRGELQSSDLFHHSKLDPDMAFCANIRQQDVFMFLTNRHTLGHLLSLDSYRTTHLHNDLWEVFSNPEDWKEKYIHQNYTKALAGKLVETPCPDVYWFPIFTEV Predict reactive species |
Full Name | procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase 1 |
Calculated Molecular Weight | 727 aa, 84 kDa |
Observed Molecular Weight | 84-88 kDa |
GenBank Accession Number | BC016657 |
Gene Symbol | PLOD1 |
Gene ID (NCBI) | 5351 |
RRID | AB_2918315 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q02809 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PLOD1, as known as procollagen‐lysine, 2‐oxoglutarate 5‐dioxygenase 1, is a member of the PLOD family(Uniprot, GeneID:5351). PLOD1 participates in catalyzing hydroxylysine residue, which is critical for the formation of covalent cross-link (PMID:30003082). PLOD1 plays an important role in the development and progression of tumors. Aberrantly expressed PLOD1 promotes cancer aggressiveness in glioma and bladder cancer, providing a potential prognostic biomarker and therapeutic target (PMID:31199049, PMID:34040895). PLOD1 has 2 isoforms produced by alternative splicing.
Protocols
Product Specific Protocols | |
---|---|
IF protocol for PLOD1 antibody 29480-1-AP | Download protocol |
IHC protocol for PLOD1 antibody 29480-1-AP | Download protocol |
WB protocol for PLOD1 antibody 29480-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Aging (Albany NY) Systematic characterization of the expression, prognosis and immune characteristics of PLOD family genes in breast cancer | ||
Phytomedicine Gluconic acid alleviates hypertrophic scar formation through binding PLOD1, reducing p-AKT signaling and activating autophagy |