Tested Applications
| Positive WB detected in | A375 cells, K-562 cells, HeLa cells, U-251 cells, U2OS cells |
| Positive IHC detected in | human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | K-562 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
29480-1-AP targets PLOD1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31626 Product name: Recombinant human PLOD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 450-564 aa of BC016657 Sequence: YISNIYLIKGSALRGELQSSDLFHHSKLDPDMAFCANIRQQDVFMFLTNRHTLGHLLSLDSYRTTHLHNDLWEVFSNPEDWKEKYIHQNYTKALAGKLVETPCPDVYWFPIFTEV Predict reactive species |
| Full Name | procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase 1 |
| Calculated Molecular Weight | 727 aa, 84 kDa |
| Observed Molecular Weight | 84-88 kDa |
| GenBank Accession Number | BC016657 |
| Gene Symbol | PLOD1 |
| Gene ID (NCBI) | 5351 |
| RRID | AB_2918315 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q02809 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PLOD1, as known as procollagen‐lysine, 2‐oxoglutarate 5‐dioxygenase 1, is a member of the PLOD family(Uniprot, GeneID:5351). PLOD1 participates in catalyzing hydroxylysine residue, which is critical for the formation of covalent cross-link (PMID:30003082). PLOD1 plays an important role in the development and progression of tumors. Aberrantly expressed PLOD1 promotes cancer aggressiveness in glioma and bladder cancer, providing a potential prognostic biomarker and therapeutic target (PMID:31199049, PMID:34040895). PLOD1 has 2 isoforms produced by alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PLOD1 antibody 29480-1-AP | Download protocol |
| IHC protocol for PLOD1 antibody 29480-1-AP | Download protocol |
| WB protocol for PLOD1 antibody 29480-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Aging (Albany NY) Systematic characterization of the expression, prognosis and immune characteristics of PLOD family genes in breast cancer | ||
Phytomedicine Gluconic acid alleviates hypertrophic scar formation through binding PLOD1, reducing p-AKT signaling and activating autophagy |











