PLP1 Polyclonal antibody

• 

  IHC staining of mouse brain using 33901-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 33901-1-AP (PLP1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human brain using 33901-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 33901-1-AP (PLP1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 33901-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 33901-1-AP (PLP1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 33901-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 33901-1-AP (PLP1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using 33901-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using PLP1 antibody (33901-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using 33901-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using PLP1 antibody (33901-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4), CoraLite® Plus 488 MBP antibody (CL488-10458, green). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PLP1 Polyclonal Antibody for IHC, IF-P, ELISA

Cat No. 33901-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF-P, ELISA

Synonyms

Lipophilin, Myelin proteolipid protein, PLP

---

Tested Applications

• Positive IHC detected in: mouse brain tissue, human brain tissue, rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33901-1-AP targets PLP1 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38738

  Product name: Recombinant human PLP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 89-151 aa of NM_000533.4

  Sequence: EGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDK

• Full Name: proteolipid protein 1
• Calculated Molecular Weight: 30kDa，277aa
• GenBank Accession Number: NM_000533.4
• Gene Symbol: PLP1
• Gene ID (NCBI): 5354
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P60201
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Myelin proteolipid protein is also named PLP1 and Lipophilin. Plp1 is abundantly expressed by oligodendrocytes of the central nervous system (CNS), where it encodes the most abundant protein in CNS myelin (PMID: 19452287). Plp1 expression preferentially occurs during early postnatal development, primarily as the DM20 isoform (PMID: 37293625).