PLTP Polyclonal antibody

• 

  WB analysis using 51123-1-AP

  human plasma was subjected to SDS PAGE followed by western blot with 51123-1-AP (PLTP antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

PLTP Polyclonal Antibody for WB, ELISA

Cat No. 51123-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

HDLCQ9, Lipid transfer protein II, phospholipid transfer protein, PLTP

---

Tested Applications

• Positive WB detected in: human plasma

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

51123-1-AP targets PLTP in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0681

  Product name: Recombinant human PLTP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC019898

  Sequence: MALFGALFLALLAGAHAVFPGCKIRVTSKALELVKQEGLRFLEQELETITIPDLRGKEGHFYYNISEVKVTELQLTSSELDFQPQQELMLQITNASLGLRFRRQLLYWFFYDGGYINASAEGVSIRTGLELSRDPAGRMKVSNVSCQASVSRMHAAFGGTFKKVYDFLSTFITSGMRFLLNQQICPVLYHAGTVLLNSLLDTVPVRSSVDELVGIDYSLMKDPVASTSNLDMDFRGAFFPLTERNWSLPNRAVEPQLQEEERMVYVAFSEFFFDSAMESYFRAGALQLLLVGDKVPHDLD

• Full Name: phospholipid transfer protein
• Calculated Molecular Weight: 54.7 kDa, 81 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC019898
• Gene Symbol: PLTP
• Gene ID (NCBI): 5360
• RRID: AB_3670234
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P55058
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PLTP (phospholipid transfer protein) belongs to the family of lipid-binding and lipid-transfer proteins. PLTP is involved in the distribution and metabolism of high density lipoprotein ( HDL ) and reverse cholesterol transfer ( RCT ). In plasma, PLTP catalyzes the transfer of phospholipids ( mainly phosphatidylcholine ) between lipoproteins (PMID: 29558025).