Tested Applications
| Positive WB detected in | fetal human brain tissue, mouse testis tissue, rat testis tissue, pig spinal cord tissue |
| Positive IHC detected in | human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12717-1-AP targets PMP2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3411 Product name: Recombinant human PMP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-132 aa of BC034997 Sequence: MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV Predict reactive species |
| Full Name | peripheral myelin protein 2 |
| Calculated Molecular Weight | 132 aa, 15 kDa |
| Observed Molecular Weight | 15-20 kDa |
| GenBank Accession Number | BC034997 |
| Gene Symbol | PMP2 |
| Gene ID (NCBI) | 5375 |
| RRID | AB_2166978 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P02689 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PMP2 (peripheral myelin protein-2, also known as P2) is one of the major proteins of peripheral myelin and appears to be related to the transport of fatty acids or the metabolism of myelin lipids.P2 constitutes up to 15% of total protein of peripheral nervous system (PNS) myelin. It is also present in small amounts in central nervous system (CNS) myelin, being abundant in spinal cord and brain stem myelin. As a structural protein, P2 is thought to stabilize the myelin membranes.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PMP2 antibody 12717-1-AP | Download protocol |
| WB protocol for PMP2 antibody 12717-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-PMP2 (Peripheral Myelin Protein 2), catalog number 12717-1-AP, has 23 citations published across 18 journals including Nature Neuroscience, Neuron, Journal of Experimental & Clinical Cancer Research, Journal of Cell Biology, Glia, Journal of Neuroscience, eLife, and BMC Cancer. Research fields span neuroscience (myelination, Schwann cell biology, CNS cell classification), oncology (bladder carcinoma, colorectal cancer, glioblastoma), lipid metabolism, and peripheral nerve physiology.
| Species | Application | Title |
|---|---|---|
Nat Neurosci Variation among intact tissue samples reveals the core transcriptional features of human CNS cell classes. | ||
Nat Neurosci Disentangling glial diversity in peripheral nerves at single-nuclei resolution. | ||
Neuron Macrophages Expressing GALC Improve Peripheral Krabbe Disease by a Mechanism Independent of Cross-Correction. | ||
Neuron Molecular pathways and diagnosis in spatially resolved Alzheimer's hippocampal atlas | ||
J Exp Clin Cancer Res ITPR3 facilitates tumor growth, metastasis and stemness by inducing the NF-ĸB/CD44 pathway in urinary bladder carcinoma. | ||
Reviews
What customers say
One reviewer, Samantha Korver, rated this antibody 5/5 stars. She used it in a Western Blot at a 1:500 dilution (Lot 00018721) and reported that it successfully detected PMP2 in human sciatic nerve tissue and also bound to myelin recombinant protein. Overall, the feedback is positive, confirming reliable performance for PMP2 detection by WB.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Samantha (Verified Customer) (08-29-2025) | This antibody was used in a Western Blot and detected PMP2 in human sciatic nerve and bound to myelin recombinant protein
|
