Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

PMP2 Polyclonal antibody

PMP2 Polyclonal Antibody for WB, IHC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF, ELISA

FABP8, M-FABP, Myelin P2 protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for PMP2 in ?

Tested Applications

Positive WB detected infetal human brain tissue, mouse testis tissue, rat testis tissue, pig spinal cord tissue
Positive IHC detected inhuman gliomas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12717-1-AP targets PMP2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3411

Product name: Recombinant human PMP2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-132 aa of BC034997

Sequence: MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV

Predict reactive species
Full Name peripheral myelin protein 2
Calculated Molecular Weight 132 aa, 15 kDa
Observed Molecular Weight 15-20 kDa
GenBank Accession NumberBC034997
Gene Symbol PMP2
Gene ID (NCBI) 5375
RRIDAB_2166978
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP02689
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PMP2 (peripheral myelin protein-2, also known as P2) is one of the major proteins of peripheral myelin and appears to be related to the transport of fatty acids or the metabolism of myelin lipids.P2 constitutes up to 15% of total protein of peripheral nervous system (PNS) myelin. It is also present in small amounts in central nervous system (CNS) myelin, being abundant in spinal cord and brain stem myelin. As a structural protein, P2 is thought to stabilize the myelin membranes.

Protocols

Product Specific Protocols
IHC protocol for PMP2 antibody 12717-1-APDownload protocol
WB protocol for PMP2 antibody 12717-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-PMP2 (Peripheral Myelin Protein 2), catalog number 12717-1-AP, has 23 citations published across 18 journals including Nature Neuroscience, Neuron, Journal of Experimental & Clinical Cancer Research, Journal of Cell Biology, Glia, Journal of Neuroscience, eLife, and BMC Cancer. Research fields span neuroscience (myelination, Schwann cell biology, CNS cell classification), oncology (bladder carcinoma, colorectal cancer, glioblastoma), lipid metabolism, and peripheral nerve physiology.

SpeciesApplicationTitle
humanIHC

Nat Neurosci

Variation among intact tissue samples reveals the core transcriptional features of human CNS cell classes.

Authors - Kevin W Kelley
mouseIHC

Nat Neurosci

Disentangling glial diversity in peripheral nerves at single-nuclei resolution.

Authors - Aldrin K Y Yim
pigWB

Neuron

Macrophages Expressing GALC Improve Peripheral Krabbe Disease by a Mechanism Independent of Cross-Correction.

Authors - Nadav I Weinstock

Neuron

Molecular pathways and diagnosis in spatially resolved Alzheimer's hippocampal atlas

Authors - Pan Wang
humanWB

J Exp Clin Cancer Res

ITPR3 facilitates tumor growth, metastasis and stemness by inducing the NF-ĸB/CD44 pathway in urinary bladder carcinoma.

Authors - Mengzhao Zhang
mouseIF

Cell Mol Neurobiol

The Role of Peripheral Myelin Protein 2 in Remyelination.

Authors - Mark Stettner

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer, Samantha Korver, rated this antibody 5/5 stars. She used it in a Western Blot at a 1:500 dilution (Lot 00018721) and reported that it successfully detected PMP2 in human sciatic nerve tissue and also bound to myelin recombinant protein. Overall, the feedback is positive, confirming reliable performance for PMP2 detection by WB.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Samantha (Verified Customer) (08-29-2025)

This antibody was used in a Western Blot and detected PMP2 in human sciatic nerve and bound to myelin recombinant protein

  • Applications: Western Blot
  • Primary Antibody Dilution: 1 in 500
  • Cell Tissue Type: N/A
Loading...
||
New chat

Able™

正在加载,请稍候...