PNPLA1 Polyclonal antibody

• 

  WB analysis using 30905-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 30905-1-AP (PNPLA1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

PNPLA1 Polyclonal Antibody for WB, ELISA

Cat No. 30905-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

PNPLA 1, ARCI10

---

Tested Applications

• Positive WB detected in: mouse spleen tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30905-1-AP targets PNPLA1 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34139

  Product name: Recombinant human PNPLA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-59 aa of BC103907

  Sequence: MVQMMRQFLYRVLPEDSYKVTTGKLHVSLTRLTDGENVVVSEFTSKEELIEALYCSCFV

• Full Name: patatin-like phospholipase domain containing 1
• Calculated Molecular Weight: 532 aa, 58 kDa
• Observed Molecular Weight: 48kDa;58kDa
• GenBank Accession Number: BC103907
• Gene Symbol: PNPLA1
• Gene ID (NCBI): 285848
• RRID: AB_3669778
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8N8W4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PNPLA1 is a member of the patatin-like phospholipase (PNPLA) family. PNPLAs are highly conserved enzymes of prokaryotic and eukaryotic organisms that play an important role in lipid homeostasis. PNPLA1 has been identified as an essential transacylase for acylceramide biosynthesis to maintain the epidermal permeability barrier (PMID: 30290227). It is mainly expressed in the skin and has 3 isoforms with MW of 58, 48 and 49 kDa.