PNPLA4 Polyclonal antibody, PBS Only

• 

  WB analysis of HeLa using 25469-1-AP (same clone as 25469-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 25469-1-AP (PNPLA4 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25469-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 25469-1-AP (same clone as 25469-1-PBS)

  IP result of anti-PNPLA4 (IP:25469-1-AP, 4ug; Detection:25469-1-AP 1:300) with HeLa cells lysate 3200ug. This data was developed using the same antibody clone with 25469-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 25469-1-AP (same clone as 25469-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 25469-1-AP (PNPLA4 antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 25469-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 25469-1-AP (same clone as 25469-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 25469-1-AP (PNPLA4 antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 25469-1-PBS in a different storage buffer formulation.

PNPLA4 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 25469-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

Calcium-independent phospholipase A2-eta, DXS1283E, EC:3.1.1.3, EC:3.1.1.4, GS2

---

Product Information

25469-1-PBS targets PNPLA4 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22091

  Product name: Recombinant human PNPLA4 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-253 aa of BC020746

  Sequence: MKHINLSFAACGFLGIYHLGAASALCRHGKKLVKDVKAFAGASAGSLGASVLLTAPEKIEECNQFTYKFAEEIRRQSFGAVTPGYDFMARLRSGMESILPPSAHELAQNRLHVSITNAKTRENHLVSTFSSREGLIKVLLASSFVPIYAGLKLVEYKGQKWVDGGLTNALPILPVGRTVTISPFSGRLDISPQDKGQLDLYVNIAKQDIMLSLANLVRLNQALFPPSKRKMESLYQCGFDDTVKFLLKENWFE

• Full Name: patatin-like phospholipase domain containing 4
• Calculated Molecular Weight: 253 aa, 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC020746
• Gene Symbol: PNPLA4
• Gene ID (NCBI): 8228
• RRID: AB_2880095
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P41247
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PNPLA4(Patatin-like phospholipase domain-containing protein 4) is also named as DXS1283E, GS2. It participate in triacylglycerol hydrolysis and the acyl-CoA independent transacylation of acylglycerols, there by facilitating energy mobilization and storage in adipocytes. This protein has 2 isoforms produced by alternative splicing.