Product Information
17596-1-AP targets POLE4 in ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag11565 Product name: Recombinant human POLE4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-117 aa of BC031331 Sequence: MAAAAAAGSGTPREEEVPAGEAAASQPQAPTSVPGARLSRLPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD Predict reactive species |
Full Name | polymerase (DNA-directed), epsilon 4 (p12 subunit) |
Calculated Molecular Weight | 117 aa, 12 kDa |
GenBank Accession Number | BC031331 |
Gene Symbol | POLE4 |
Gene ID (NCBI) | 56655 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9NR33 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |