Product Information
17596-1-AP targets POLE4 in ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11565 Product name: Recombinant human POLE4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-117 aa of BC031331 Sequence: MAAAAAAGSGTPREEEVPAGEAAASQPQAPTSVPGARLSRLPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD Predict reactive species |
| Full Name | polymerase (DNA-directed), epsilon 4 (p12 subunit) |
| Calculated Molecular Weight | 117 aa, 12 kDa |
| GenBank Accession Number | BC031331 |
| Gene Symbol | POLE4 |
| Gene ID (NCBI) | 56655 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NR33 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
