Tested Applications
Positive WB detected in | A549 cells, human brain tissue, HeLa cells, MCF-7 cells |
Positive IP detected in | A549 cells |
Positive IHC detected in | human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | A549 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 3 publications below |
Product Information
16403-1-AP targets POLR2J in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag9520 Product name: Recombinant human POLR2J protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC024165 Sequence: MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEG Predict reactive species |
Full Name | polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa |
Calculated Molecular Weight | 115 aa, 13 kDa |
Observed Molecular Weight | 13 kDa |
GenBank Accession Number | BC024165 |
Gene Symbol | POLR2J |
Gene ID (NCBI) | 5439 |
RRID | AB_10666162 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P52435 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for POLR2J antibody 16403-1-AP | Download protocol |
IHC protocol for POLR2J antibody 16403-1-AP | Download protocol |
IF protocol for POLR2J antibody 16403-1-AP | Download protocol |
IP protocol for POLR2J antibody 16403-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Mol Cell RNA Pol II preferentially regulates ribosomal protein expression by trapping disassociated subunits | ||
Mol Cell Targeted protein degradation reveals RNA Pol II heterogeneity and functional diversity | ||
Am J Cancer Res POLR2J expression promotes glioblastoma malignancy by regulating oxidative stress and the STAT3 signaling pathway | ||
Cell Biosci Replication and transcription machinery for ranaviruses: components, correlation, and functional architecture.
| ||
Genome Biol Cross-regulome profiling of RNA polymerases highlights the regulatory role of polymerase III on mRNA transcription by maintaining local chromatin architecture |