Tested Applications
Positive WB detected in | Raji cells, HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
15779-1-AP targets POLR2L in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag8468 Product name: Recombinant human POLR2L protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-67 aa of BC005903 Sequence: MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK Predict reactive species |
Full Name | polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa |
Calculated Molecular Weight | 67 aa, 8 kDa |
Observed Molecular Weight | 8 kDa |
GenBank Accession Number | BC005903 |
Gene Symbol | POLR2L |
Gene ID (NCBI) | 5441 |
RRID | AB_2167979 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P62875 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for POLR2L antibody 15779-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |