POLR2L Polyclonal antibody

• 

  WB analysis of Raji using 15779-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 15779-1-AP (POLR2L antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 15779-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15779-1-AP (POLR2L antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

POLR2L Polyclonal Antibody for WB, ELISA

Cat No. 15779-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

hRPB7.6, hsRPB10b, POLR2L, RBP10, RPABC5, RPB10, RPB10 homolog, RPB10beta, RPB7.6

---

Tested Applications

• Positive WB detected in: Raji cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15779-1-AP targets POLR2L in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8468

  Product name: Recombinant human POLR2L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-67 aa of BC005903

  Sequence: MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK

• Full Name: polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa
• Calculated Molecular Weight: 67 aa, 8 kDa
• Observed Molecular Weight: 8 kDa
• GenBank Accession Number: BC005903
• Gene Symbol: POLR2L
• Gene ID (NCBI): 5441
• RRID: AB_2167979
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P62875
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.