Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Periostin Polyclonal antibody

Periostin Polyclonal Antibody for IHC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

IHC, IF, ELISA

OSF 2, OSF2, OSF-2, Osteoblast specific factor 2, Osteoblast-specific factor 2

Formulation:  PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Periostin in ?

Tested Applications

Positive IHC detected inhuman colon tissue, human breast cancer tissue, human skin cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

19899-1-AP targets Periostin in IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13791

Product name: Recombinant human POSTN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 21-368 aa of BC106710

Sequence: ANNHYDKILAHSRIRGRDQGPNVCALQQILGTKKKYFSTCKNWYKKSICGQKTTVLYECCPGYMRMEGMKGCPAVLPIDHVYGTLGIVGATTTQRYSDASKLREEIEGKGSFTYFAPSNEAWDNLDSDIRRGLESNVNVELLNALHSHMINKRMLTKDLKNGMIIPSMYNNLGLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEALMKYHILNTLQCSESIMGGAVFETLEGNTIEIGCDGDSITVNGIKMVNKKDIVTNNGVIHLIDQVLIPD

Predict reactive species
Full Name periostin, osteoblast specific factor
Calculated Molecular Weight 93 kDa
GenBank Accession NumberBC106710
Gene Symbol Periostin
Gene ID (NCBI) 10631
RRIDAB_10732682
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ15063
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Periostin (POSTN, PN), originally named as osteoblast-specific factor 2 (OSF-2), is a 90-kDa secreted protein which is now classified as a matricellular protein. It is present in a wide variety of normal adult tissues and fetal tissues, and has a role in bone, tooth and heart development and function. Studies show that periostin is overexpressed in a broad range of human cancer types, including lung, ovary, breast and colon cancers. Recent evidence reveals that periostin is expressed by fibroblasts in the normal tissue and in the stroma of the primary tumour, and it is required to allow cancer stem cell maintenance. The isoforms of periostin are between 83 and 93 kDa in mass and differ in their C-terminal sequences, characterized by individual presence or absence of cassette exons 17-21 (UniProtKB/Swiss-Prot,PMID: 21997759).

Publications

What published studies show

The Periostin Polyclonal antibody (Cat# 19899-1-AP) has accumulated 41 citations published in journals including Nature Communications, Journal of Clinical Investigation, ACS Nano, Cell Death & Disease, Biomaterials, and Advanced Science. Associated research fields encompass cardiac fibrosis and heart failure, periodontal disease and bone regeneration, diverse cancers (esophageal, breast, ovarian, lung, colorectal), renal and pulmonary fibrosis, angiogenesis, tissue repair, and diabetic complications.

SpeciesApplicationTitle
mouseIF

Bone Res

Loss of PTH 1 receptor signaling in periodontal cells drives cementum dysfunction and molar ankylosis in mice.

Authors - Hakan Turkkahraman
zebrafishIF

Nat Commun

Harnessing the regenerative potential of interleukin11 to enhance heart repair

Authors - Kwangdeok Shin
humanIF

Nat Commun

LTBP4 deficiency inhibits NLRP3 inflammasome activation in cardiomyocytes and attenuates heart failure in male mice

Authors - Siyu Ma
humanIF

Exp Mol Med

Single-cell RNA sequencing and spatial transcriptomics of esophageal squamous cell carcinoma with lymph node metastases

Authors - Wei Guo
ratIF

ACS Nano

Multifunctional Injectable Bioadhesive with Toll-like Receptor 4 and Myeloid Differentiation Factor 2 Antagonistic Anti-inflammatory Potential for Periodontal Regeneration

Authors - Shuting Gao
mouse,humanIF

J Nanobiotechnology

Graphene quantum dots rescue angiogenic retinopathy via blocking STAT3/Periostin/ERK signaling.

Authors - Na Zhao
Loading...
||
New chat

Able™

正在加载,请稍候...