POT1 Monoclonal antibody

• 

  WB analysis using 60556-7-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 60556-7-Ig (POT1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

POT1 Monoclonal Antibody for WB, ELISA

Cat No. 60556-7-Ig

Clone No.1G1C2

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, ELISA

Synonyms

hPot1, POT1-like telomere end-binding protein

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, MOLT-4 cells, Daudi cells, Karpas-422 cells, Ramos cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60556-7-Ig targets POT1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36974

  Product name: Recombinant human POT1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 336-634 aa of BC002923

  Sequence: ILTDHQYLERTPLCAILKQKAPQQYRIRAKLRSYKPRRLFQSVKLHCPKCHLLQEVPHEGDLDIIFQDGATKTPDVKLQNTSLYDSKIWTTKNQKGRKVAVHFVKNNGILPLSNECLLLIEGGTLSEICKLSNKFNSVIPVRSGHEDLELLDLSAPFLIQGTIHHYGCKQCSSLRSIQNLNSLVDKTSWIPSSVAEALGIVPLQYVFVMTFTLDDGTGVLEAYLMDSDKFFQIPASEVLMDDDLQKSVDMIMDMFCPPGIKIDAYPWLECFIKSYNVTNGTDNQICYQIFDTTVAEDVI

• Full Name: POT1 protection of telomeres 1 homolog (S. pombe)
• Calculated Molecular Weight: 71 kDa
• Observed Molecular Weight: 71 kDa
• GenBank Accession Number: BC002923
• Gene Symbol: POT1
• Gene ID (NCBI): 25913
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NUX5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Protection of telomeres 1(POT1) is a conserved protein that binds the G-rich stand of its own telomeric repeat sequence, with a role in protecting chromosome ends. It's housekeeping gene that is required to ensure the integrity of chromosome ends in all cells. It's a component of the telomerase ribonucleoprotein(RNP) complex that is esential for the replication of chromosome termini. It consists the TRF1 compex that is involved in the regulation of telomere length by cis-inhibition of telomerase. We have discovered that POT1 exists in at least three consistently occurring forms; 90, 70 and 45kDa. The unexpected molecular weights of POT1 seem to be associated with SUMO1 and ubiquitin conjugation; the latter occurring at a double lysine residue at 289-KK-290 (.PMID: 24054699)