POT1 Monoclonal antibody, PBS Only

POT1 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 60556-7-PBS
Clone No.1G1C2

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, Indirect ELISA

hPot1, POT1-like telomere end-binding protein

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60556-7-PBS targets POT1 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag36974

Product name: Recombinant human POT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 336-634 aa of BC002923

Sequence: ILTDHQYLERTPLCAILKQKAPQQYRIRAKLRSYKPRRLFQSVKLHCPKCHLLQEVPHEGDLDIIFQDGATKTPDVKLQNTSLYDSKIWTTKNQKGRKVAVHFVKNNGILPLSNECLLLIEGGTLSEICKLSNKFNSVIPVRSGHEDLELLDLSAPFLIQGTIHHYGCKQCSSLRSIQNLNSLVDKTSWIPSSVAEALGIVPLQYVFVMTFTLDDGTGVLEAYLMDSDKFFQIPASEVLMDDDLQKSVDMIMDMFCPPGIKIDAYPWLECFIKSYNVTNGTDNQICYQIFDTTVAEDVI

Predict reactive species
Full Name POT1 protection of telomeres 1 homolog (S. pombe)
Calculated Molecular Weight 71 kDa
Observed Molecular Weight 71 kDa
GenBank Accession NumberBC002923
Gene Symbol POT1
Gene ID (NCBI) 25913
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NUX5
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Protection of telomeres 1(POT1) is a conserved protein that binds the G-rich stand of its own telomeric repeat sequence, with a role in protecting chromosome ends. It's housekeeping gene that is required to ensure the integrity of chromosome ends in all cells. It's a component of the telomerase ribonucleoprotein(RNP) complex that is esential for the replication of chromosome termini. It consists the TRF1 compex that is involved in the regulation of telomere length by cis-inhibition of telomerase. We have discovered that POT1 exists in at least three consistently occurring forms; 90, 70 and 45kDa. The unexpected molecular weights of POT1 seem to be associated with SUMO1 and ubiquitin conjugation; the latter occurring at a double lysine residue at 289-KK-290 (.PMID: 24054699)

Loading...
||
New chat Able
正在加载,请稍候...