Tested Applications
Positive WB detected in | DU 145 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
24837-1-AP targets POTEH in WB, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag20275 Product name: Recombinant human POTEH protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-59 aa of BC148758 Sequence: MGKWCRHCFAWCRGSGKSNVGTSGDHDDSAMKTLRS Predict reactive species |
Full Name | POTE ankyrin domain family, member H |
Calculated Molecular Weight | 545 aa, 61 kDa |
Observed Molecular Weight | 61 kDa |
GenBank Accession Number | BC148758 |
Gene Symbol | POTEH |
Gene ID (NCBI) | 23784 |
RRID | AB_2879752 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q6S545 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for POTEH antibody 24837-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |