PPA1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68178-1-Ig (same clone as 68178-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68178-1-Ig (PPA1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68178-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 68178-1-Ig (same clone as 68178-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using PPA1 antibody (68178-1-Ig, Clone: 1D11F4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68178-1-PBS in a different storage buffer formulation.

PPA1 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 68178-1-PBS

Clone No.1D11F4

Host / Isotype

Mouse / IgG1

Reactivity

Human, Rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Inorganic pyrophosphatase, IOPPP, PP, PP1, PPA1, PPase, pyrophosphatase (inorganic) 1, SID6 8061

---

Product Information

68178-1-PBS targets PPA1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human, Rat samples.

• Tested Reactivity: Human, Rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7049

  Product name: Recombinant human PPA1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-289 aa of BC001022

  Sequence: MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDHWKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDVDKWFHHQKN

• Full Name: pyrophosphatase (inorganic) 1
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC001022
• Gene Symbol: PPA1
• Gene ID (NCBI): 5464
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q15181
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PPA1(Inorganic pyrophosphatase) is also named as IOPPP, PP and PPase. It maintains the thermodynamic favorability of these reactions by catalyzing the hydrolysis of pyrophosphates into organic phosphates, which are then exported across the cell membrane(PMID:16300924).The erythrocyte inorganic pyrophosphatase molecule would appear to be a dimer(PMID:4130389).