Tested Applications
Positive WB detected in | human placenta tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 4 publications below |
IHC | See 1 publications below |
Product Information
28053-1-AP targets PPARD in WB, IHC, ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Cited Reactivity | human, bovine |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag27817 Product name: Recombinant human PPARD protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-73 aa of BC002715 Sequence: MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQMGCDGASCGSLNME Predict reactive species |
Full Name | peroxisome proliferator-activated receptor delta |
Calculated Molecular Weight | 50 kDa |
Observed Molecular Weight | 50 kDa |
GenBank Accession Number | BC002715 |
Gene Symbol | PPARD |
Gene ID (NCBI) | 5467 |
RRID | AB_2918143 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q03181 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for PPARD antibody 28053-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Chem Biol Interact f25, a novel synthetic quinoline derivative, inhibits tongue cancer cell invasion and survival by the PPAR pathway in vitro and vivo | ||
Antioxidants (Basel) Ginsenoside Rg1 Alleviates Blood-Milk Barrier Disruption in Subclinical Bovine Mastitis by Regulating Oxidative Stress-Induced Excessive Autophagy | ||
Eur J Pharmacol GW501516 facilitated tumor immune escape by inhibiting phagocytosis
| ||