• Featured Product
  • KD/KO Validated

PPAR Gamma Polyclonal antibody

PPAR Gamma Polyclonal Antibody for WB, IHC, IF-P, FC (Intra), IP, ELISA

Cat No. 16643-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (7)

Applications

WB, IHC, IF-P, FC (Intra), IP, CoIP, CHIP, ELISA

PPARG, NR1C3, Peroxisome proliferator-activated receptor gamma, PPAR-gamma, PPARγ

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inK-562 cells, HL-60 cells, mouse heart tissue, MCF-7 cells, U-937 cells
Positive IP detected inHL-60 cells
Positive IHC detected inhuman prostate cancer tissue, human breast cancer tissue, human colon cancer tissue, human placenta tissue, human thyroid cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inrat liver tissue
Positive FC (Intra) detected inHeLa cells

This antibody is not recommended for immunocytofluorescent assays.

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:5000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16643-1-AP targets PPAR Gamma in WB, IHC, IF-P, FC (Intra), IP, CoIP, CHIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, rabbit, monkey, chicken, zebrafish, hamster, sheep, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10005

Product name: Recombinant human PPARG protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 161-477 aa of BC006811

Sequence: KCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY

Predict reactive species
Full Name peroxisome proliferator-activated receptor gamma
Calculated Molecular Weight 58 kDa
Observed Molecular Weight 50-60 kDa
GenBank Accession NumberBC006811
Gene Symbol PPARG
Gene ID (NCBI) 5468
RRIDAB_10596794
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP37231
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Peroxisome Proliferator-Activated Receptors (PPARs) are ligand-activated intracellular transcription factors, members of the nuclear hormone receptor superfamily (NR), that includes estrogen, thyroid hormone receptors, retinoic acid, Vitamin D3 as well as retinoid X receptors (RXRs). The PPAR subfamily consists of three subtypes encoded by distinct genes denoted PPARα (NR1C1), PPARβ/δ (NR1C2) and PPARγ (NR1C3), which are activated by selective ligands. PPARγ, also named as PPARG, contains one nuclear receptor DNA-binding domain and is a receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. It plays an important role in the regulation of lipid homeostasis, adipogenesis, ins resistance, and development of various organs. Defects in PPARG are the cause of familial partial lipodystrophy type 3 (FPLD3) and may be associated with susceptibility to obesity. Defects in PPARG can lead to type 2 ins-resistant diabetes and hypertension. PPARG mutations may be associated with colon cancer. Genetic variations in PPARG are associated with susceptibility to glioma type 1 (GLM1). PPARG has two isoforms with molecular weight 57 kDa and 54 kDa (PMID: 9831621), but modified PPARG is about 67 KDa (PMID: 16809887). PPARG2 is a splice variant and has an additional 30 amino acids at the N-terminus (PMID: 15689403). Experimental data indicate that a 45 kDa protein displaying three different sequences immunologically related to the nuclear receptor PPARG2 is located in mitochondria (mt-PPAR). However, the molecular weight of this protein is clearly less when compared to that of PPARG2 (57 kDa) (PMID: 10922459). PPARG has been reported to be localized mainly (but not always) in the nucleus. PPARG can also be detected in the cytoplasm and was reported to possess extra-nuclear/non-genomic actions (PMID: 17611413; 19432669; 14681322).

Protocols

Product Specific Protocols
FC protocol for PPAR Gamma antibody 16643-1-APDownload protocol
IF protocol for PPAR Gamma antibody 16643-1-APDownload protocol
IHC protocol for PPAR Gamma antibody 16643-1-APDownload protocol
IP protocol for PPAR Gamma antibody 16643-1-APDownload protocol
WB protocol for PPAR Gamma antibody 16643-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Nat Nanotechnol

Photoacoustic molecular imaging-escorted adipose photodynamic-browning synergy for fighting obesity with virus-like complexes.

Authors - Ronghe Chen
mouseWB,IF

ACS Nano

Dual Inhibition of Endoplasmic Reticulum Stress and Oxidation Stress Manipulates the Polarization of Macrophages under Hypoxia to Sensitize Immunotherapy.

Authors - Mengshi Jiang
mouseWB,IF

Adv Sci (Weinh)

Photothermal-Responsive Soluble Microneedle Patches for Meibomian Gland Dysfunction Therapy

Authors - Fei Yu
mouseWB

J Pineal Res

Single-cell RNA sequencing of preadipocytes reveals the cell fate heterogeneity induced by melatonin.

Authors - Zhenhui Li

Biomaterials

Engineered peripheral CD4 T cells delivery across the BBB promote intracerebral Treg conversion unleashes microglial phagocytotic activity for Alzheimer's disease treatment

Authors - Zejie Zuo
mouseWB,IHC

Nat Commun

N1-methyladenosine methylation in tRNA drives liver tumourigenesis by regulating cholesterol metabolism.

Authors - Yanying Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Tianyi (Verified Customer) (08-30-2024)

Antigen retrieval in Tris/EDTA buffer and incubated with AF594 at room temperature for 2 hours.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Ovarian tissue
PPAR Gamma Antibody Immunofluorescence validation (1:100 dilution) in Ovarian tissue (Cat no:16643-1-AP)
FH

Surendra (Verified Customer) (12-30-2023)

I purchased this antibody by seeing single band on web page, but it is giving several bands, so its really tough to determine which band is real PPAR gamma.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Pancreatic Cancer Cells
FH

Giulia (Verified Customer) (02-21-2022)

The antibody performed well

  • Applications: Immunofluorescence
FH

Boyan (Verified Customer) (04-24-2019)

By WB, this antibody labeled many bands, which makes it very hard to distinguish which one is the actual PPARg.

  • Applications: Western Blot,
  • Cell Tissue Type: 3T3 L1
Loading...
||
New chat

Able

正在加载,请稍候...