PPARGC1B Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• PPARGC1B Recombinant monoclonal antibody (86997-1-RR)

• 

  WB analysis using 86997-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86997-1-RR (PPARGC1B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 86997-1-RR

  Biolayer interferometry (BLI) kinetic assays of 86997-1-RR against Human PPP1R12B were performed. The affinity constant is 1.27 nM.

PPARGC1B Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86997-1-RR

Clone No.252087B4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

ERRL1, PERC, Peroxisome proliferator activated receptor gamma coactivator 1 beta, Peroxisome proliferator-activated receptor gamma coactivator 1-beta, PGC1

---

Tested Applications

• Positive WB detected in: NIH/3T3 cells, mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86997-1-RR targets PPARGC1B in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag17566

  Product name: Recombinant human PPARGC1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC132971

  Sequence: MAGNDCGALLDEELSSFFLNYLADTQGGGSGEEQLYADFPELDLSQLDASDFDSATCFGELQWCPENSETEPNQYSPDDSELFQIDSENEALLAELTKTLDDIPEDDVGLAAFPALDGGDALSCTSASPAPSSAPPSPAPEKPSAPAPEVDELSLLQKLLLATSYPTSSSDTQKEGTAWRQAGLRSKSQRPCVKADSTQDKKAPMMQSQSRSCTELHKHLTSAQCCLQDRGLQPPCLQSPRLPAKEDKEPGEDCPSPQPAPASPRDSLALGRADPGAPVSQEDMQAMVQLIRYMHTYCLPQRKLPPQTPEPLPKACSNPSQQVRSRPWSRHHSKASWAEFSILRELLAQD

• Full Name: peroxisome proliferator-activated receptor gamma, coactivator 1 beta
• Calculated Molecular Weight: 1023 aa, 113 kDa
• Observed Molecular Weight: 100-110 kDa
• GenBank Accession Number: BC132971
• Gene Symbol: PPARGC1B
• Gene ID (NCBI): 133522
• RRID: AB_3745265
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q86YN6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PPARGC1B (Peroxisome Proliferator-Activated Receptor Gamma Coactivator 1-Beta) is a transcriptional coactivator that plays a key role in the regulation of cellular energy metabolism, particularly in tissues with high metabolic demands such as the heart, skeletal muscle, liver, and brain. Encoded by the PPARGC1B gene in humans, it interacts with a variety of nuclear receptors and transcription factors, including PPARs, ERRs, and NRF1, to promote the expression of genes involved in mitochondrial biogenesis, oxidative phosphorylation, fatty acid oxidation, and glucose homeostasis. Unlike its close paralog PGC-1α, PGC-1β is less responsive to physiological stimuli like cold exposure or exercise but is more constitutively expressed and tightly linked to lipid metabolism and reactive oxygen species (ROS) detoxification.