Product Information
13313-1-PBS targets CXCL7/PPBP in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4147 Product name: Recombinant human PPBP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 31-128 aa of BC028217 Sequence: TALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD Predict reactive species |
| Full Name | pro-platelet basic protein (chemokine (C-X-C motif) ligand 7) |
| Calculated Molecular Weight | 128 aa, 14 kDa |
| Observed Molecular Weight | 8-14 kDa |
| GenBank Accession Number | BC028217 |
| Gene Symbol | PPBP |
| Gene ID (NCBI) | 5473 |
| RRID | AB_10597238 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P02775 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
PPBP, also named as CXCL7, NAP2, or β-Thromboglobulin, is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by synovial cells.









