CXCL7/PPBP Polyclonal antibody, PBS Only

• 

  WB analysis of mouse liver using 13313-1-AP (same clone as 13313-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 13313-1-AP (PPBP,NAP2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13313-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human plasma using 13313-1-AP (same clone as 13313-1-PBS)

  human blood were subjected to SDS PAGE followed by western blot with 13313-1-AP (PPBP,NAP2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13313-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human liver using 13313-1-AP (same clone as 13313-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 13313-1-AP (PPBP,NAP2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13313-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse placenta using 13313-1-AP (same clone as 13313-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse placenta tissue slide using 13313-1-AP (CXCL7/PPBP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13313-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 13313-1-AP (same clone as 13313-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 13313-1-AP (CXCL7/PPBP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13313-1-PBS in a different storage buffer formulation.

CXCL7/PPBP Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 13313-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

PPBP,NAP2, CXCL7, NAP-2, PPBP, PPBP/NAP2

---

Product Information

13313-1-PBS targets CXCL7/PPBP in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4147

  Product name: Recombinant human PPBP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 31-128 aa of BC028217

  Sequence: TALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD

• Full Name: pro-platelet basic protein (chemokine (C-X-C motif) ligand 7)
• Calculated Molecular Weight: 128 aa, 14 kDa
• Observed Molecular Weight: 8-14 kDa
• GenBank Accession Number: BC028217
• Gene Symbol: PPBP
• Gene ID (NCBI): 5473
• RRID: AB_10597238
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P02775
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PPBP, also named as CXCL7, NAP2, or β-Thromboglobulin, is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by synovial cells.