Tested Applications
Positive IHC detected in | mouse brain tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
25295-1-AP targets PPFIA4 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag18130 Product name: Recombinant human PPFIA4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-78 aa of BC132925 Sequence: MGSAADVRFSLGTTTHAPPGVHRRYSALREESAKDWETSPLPGMLAPAAGPAFDSDPEISDVDEDEPGGLVGSADVVS Predict reactive species |
Full Name | protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 4 |
Calculated Molecular Weight | 701 aa, 78 kDa |
GenBank Accession Number | BC132925 |
Gene Symbol | PPFIA4 |
Gene ID (NCBI) | 8497 |
RRID | AB_3085783 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O75335 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Protein tyrosine phosphatase receptor type F polypeptide interacting protein alpha 4 (PPFIA4), also named as Liprin alpha 4, belongs to the liprin family and Liprin-alpha subfamily. PPFIA4 has been reported as a new potential therapeutic target for refractory pancreatic cancer, small cell lung cancer, and clear cell renal cell cancer (PMID: 35382861). As a glycolysis-related oncogene, PPFIA4 is also a potential biomarker of colon cancer (PMID: 34094943).
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for PPFIA4 antibody 25295-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |