PPFIA4 Polyclonal antibody

• 

  IHC staining of mouse brain using 25295-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 25295-1-AP (PPFIA4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 25295-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 25295-1-AP (PPFIA4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 25295-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 25295-1-AP (PPFIA4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 25295-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 25295-1-AP (PPFIA4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PPFIA4 Polyclonal Antibody for IHC, ELISA

Cat No. 25295-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, ELISA

Synonyms

KIAA0897, Liprin alpha 4, PPFIA4

---

Tested Applications

• Positive IHC detected in: mouse brain tissue, rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25295-1-AP targets PPFIA4 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18130

  Product name: Recombinant human PPFIA4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-78 aa of BC132925

  Sequence: MGSAADVRFSLGTTTHAPPGVHRRYSALREESAKDWETSPLPGMLAPAAGPAFDSDPEISDVDEDEPGGLVGSADVVS

• Full Name: protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 4
• Calculated Molecular Weight: 701 aa, 78 kDa
• GenBank Accession Number: BC132925
• Gene Symbol: PPFIA4
• Gene ID (NCBI): 8497
• RRID: AB_3085783
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75335
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Protein tyrosine phosphatase receptor type F polypeptide interacting protein alpha 4 (PPFIA4), also named as Liprin alpha 4, belongs to the liprin family and Liprin-alpha subfamily. PPFIA4 has been reported as a new potential therapeutic target for refractory pancreatic cancer, small cell lung cancer, and clear cell renal cell cancer (PMID: 35382861). As a glycolysis-related oncogene, PPFIA4 is also a potential biomarker of colon cancer (PMID: 34094943).