PPIF Polyclonal antibody, PBS Only

• 

  WB analysis using 18466-1-AP (same clone as 18466-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18466-1-AP (PPIF antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18466-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 18466-1-AP (same clone as 18466-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 18466-1-AP (PPIF-Specific antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18466-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 18466-1-AP (same clone as 18466-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 18466-1-AP (PPIF-Specific antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18466-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat heart using 18466-1-AP (same clone as 18466-1-PBS)

  rat heart tissue were subjected to SDS PAGE followed by western blot with 18466-1-AP (PPIF-Specific Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18466-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse heart using 18466-1-AP (same clone as 18466-1-PBS)

  IP result of anti-PPIF (IP:18466-1-AP, 3ug; Detection:18466-1-AP 1:1000) with mouse heart tissue lysate 4000ug. This data was developed using the same antibody clone with 18466-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 18466-1-AP (same clone as 18466-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 18466-1-AP (CYPA Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 18466-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 18466-1-AP (same clone as 18466-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 18466-1-AP (PPIF Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 18466-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 18466-1-AP (same clone as 18466-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart using 18466-1-AP (PPIF-Specific antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 18466-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 18466-1-AP (same clone as 18466-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart using 18466-1-AP (PPIF-Specific antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 18466-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 18466-1-AP (same clone as 18466-1-PBS)

  Immunofluorescent analysis of MCF-7 cells, using PPIF antibody 18466-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 18466-1-PBS in a different storage buffer formulation.

PPIF Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 18466-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

PPIF-Specific, Cyclophilin D, Cyclophilin F, Cyp D, CyP-D

---

Product Information

18466-1-PBS targets PPIF in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13151

  Product name: Recombinant human PPIF-Specific protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-207 aa of BC005020

  Sequence: MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS

• Full Name: peptidylprolyl isomerase F
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC005020
• Gene Symbol: PPIF
• Gene ID (NCBI): 10105
• RRID: AB_2169273
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P30405
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PPIF, also named as Cyclophilin D (CypD), CYP3, PPIase F and Rotamase F, belongs to the cyclophilin-type PPIase family. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPIF is a mitochondrial matrix protein involved in the induction of necrotic and apoptotic cell death through the activation of the mitochondrial permeability transition (mPT) pore. This antibody is immunized with full length gene PPIF and absorbed by PPIA. So this antibody is specific to PPIF.