PPIL2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87496-1-RR (same clone as 87496-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87496-1-RR (PPIL2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87496-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 87496-1-RR (same clone as 87496-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 87496-1-RR (PPIL2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87496-1-PBS in a different storage buffer formulation.

PPIL2 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87496-1-PBS

Clone No.252848F8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Cyclophilin-60, Cyclophilin-like protein Cyp-60, Cyp-60, EC:2.3.2.27, hCyP-60

---

Product Information

87496-1-PBS targets PPIL2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg6018

  Product name: Recombinant human PPIL2 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 280-457 aa of NM_148176.2

  Sequence: GYVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHYYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQERKTQLKVAP

• Full Name: peptidylprolyl isomerase (cyclophilin)-like 2
• Calculated Molecular Weight: 59 kDa
• GenBank Accession Number: NM_148176.2
• Gene Symbol: PPIL2
• Gene ID (NCBI): 23759
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13356-2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Peptidylprolyl isomerase (cyclophilin)-like 2 (PPIL2), also known as Cyclophilin-like protein Cyp-60, is a U-box-type E3 ubiquitin ligase belonging to the cyclophilin family. PPIL2 is also a target of the JAK2/STAT5 pathway and upregulated in patients with MPNs (PMID: 36092721, 25992900). PPIL2 is a large ~60 kDa (520 amino acids) protein that has a central cyclophilin-like domain and also has an N-terminal U-box domain that exhibits E3 ligase activity. Western detected PPIL2 at an apparent molecular mass of 60~70 kDa (PMID: 40338661, 29352246).