PPL Polyclonal antibody

• 

  WB analysis using 31296-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31296-1-AP (PPL antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse skin using 31296-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 31296-1-AP (PPL antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skin using 31296-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 31296-1-AP (PPL antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat skin using 31296-1-AP

  Immunohistochemical analysis of paraffin-embedded rat skin tissue slide using 31296-1-AP (PPL antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat skin using 31296-1-AP

  Immunohistochemical analysis of paraffin-embedded rat skin tissue slide using 31296-1-AP (PPL antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HaCaT using 31296-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HaCaT cells using PPL antibody (31296-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

PPL Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 31296-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

periplakin, KIAA0568

---

Tested Applications

• Positive WB detected in: A431 cells, mouse skin tissue, rat skin tissue
• Positive IHC detected in: mouse skin tissue, rat skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HaCaT cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:100-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31296-1-AP targets PPL in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34952

  Product name: Recombinant human PPL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 50-250 aa of BC114620

  Sequence: AKMQSDLARLQEGRQPEHRDVTLQKVLDSEKLLYVLEADAAIAKHMKHPQGDMIAEDIRQLKERVTNLRGKHKQIYRLAVKEVDPQVNWAALVEEKLDKLNNQSFGTDLPLVDHQVEEHNIFHNEVKAIGPHLAKDGDKEQNSELRAKYQKLLAASQARQQHLSSLQDYMQRCTNELYWLDQQAKGRMQYDWSDRNLDYPS

• Full Name: periplakin
• Observed Molecular Weight: 205 kDa
• GenBank Accession Number: BC114620
• Gene Symbol: PPL
• Gene ID (NCBI): 5493
• RRID: AB_3669933
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O60437
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Periplakin (PPL) is a main member in plakin family, which serve as epidermal cytolinkers and components of cell-cell and cell-matrix adhesion complexes, i.e., desmosomes and hemidesmosomes, respectively (PMID: 35612641). Periplakin participates with dynamic changes in the keratin cytoskeleton via its C-terminal linker domain that co-localises with okadaic-acid-treated keratin granules (PMID: 17158917).