Product Information
68122-1-PBS targets PPP1CC in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag32348 Product name: Recombinant human PPP1CC protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 206-323 aa of BC014073 Sequence: WSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK Predict reactive species |
Full Name | protein phosphatase 1, catalytic subunit, gamma isoform |
Calculated Molecular Weight | 35 kDa |
Observed Molecular Weight | 35 kDa |
GenBank Accession Number | BC014073 |
Gene Symbol | PPP1CC |
Gene ID (NCBI) | 5501 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P36873 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
PPP1CC, also named as PP-1G, belongs to the PPP phosphatase family and PP-1 subfamily. Protein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. It is involved in regulation of ionic conductances and long-term synaptic plasticity. PPP1CC may play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca2+/calmodulin dependent protein kinase II.