PPP1CC Monoclonal antibody, PBS Only

• 

  WB analysis using 68122-1-Ig (same clone as 68122-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68122-1-Ig (PPP1CC antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control. This data was developed using the same antibody clone with 68122-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 68122-1-Ig (same clone as 68122-1-PBS)

  WB result of PPP1CC antibody (68122-1-Ig; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PPP1CC transfected HEK-293 cells. This data was developed using the same antibody clone with 68122-1-PBS in a different storage buffer formulation.

• 

  IF Staining of C2C12 using 68122-1-Ig (same clone as 68122-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed C2C12 cells using PPP1CC antibody (68122-1-Ig, Clone: 2G11C3 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68122-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 68122-1-Ig (same clone as 68122-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using PPP1CC antibody (68122-1-Ig, Clone: 2G11C3 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 68122-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PPP1CC Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 68122-1-PBS

Clone No.2G11C3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

2G11C3, EC:3.1.3.16, PP-1G, Serine/threonine-protein phosphatase PP1-gamma catalytic subunit

---

Product Information

68122-1-PBS targets PPP1CC in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32348

  Product name: Recombinant human PPP1CC protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 206-323 aa of BC014073

  Sequence: WSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK

• Full Name: protein phosphatase 1, catalytic subunit, gamma isoform
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC014073
• Gene Symbol: PPP1CC
• Gene ID (NCBI): 5501
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P36873
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PPP1CC, also named as PP-1G, belongs to the PPP phosphatase family and PP-1 subfamily. Protein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. It is involved in regulation of ionic conductances and long-term synaptic plasticity. PPP1CC may play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca2+/calmodulin dependent protein kinase II.