iASPP Recombinant monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 86044-1-RR (same clone as 86044-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86044-1-RR (iASPP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86044-1-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA sample test of MP02334-1

  The mean iASPP concentration was determined to be 32.51 ng/mL in PC-3 cell extract based on a 2.0 mg/mL extract load and 68.98 ng/mL in MCF-7 cell extract based on a 1.3 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP02334-1

  Sandwich ELISA standard curve of MP02334-1, Human iASPP Recombinant Matched Antibody Pair - PBS only. 86044-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag13273. 86044-1-PBS was HRP conjugated as the detection antibody. Range: 0.313-20 ng/mL

• 

  Affinity and Kinetic Characterization of 86044-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86044-1-RR against Human PPP1R13L were performed. The affinity constant is below 1 pM.

iASPP Uni-rAb^® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA

Cat No. 86044-1-PBS

Clone No.250633E12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Sandwich ELISA, Indirect ELISA

Synonyms

PPP1R13L, Inhibitor of ASPP protein, NFkB-interacting protein 1, NKIP1, PPP1R13B like protein

---

Product Information

86044-1-PBS targets iASPP as part of a matched antibody pair:

MP02334-1: 86044-3-PBS capture and 86044-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13273

  Product name: Recombinant human PPP1R13L protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 481-829 aa of BC064913

  Sequence: EGPVARPLSPTRLQPALPPEAQSVPELEEVARVLAEIPRPLKRRGSMEQAPAVALPPTHKKQYQQIISRLFHRHGGPGPGGPEPELSPITEGSEARAGPPAPAPPAPIPPPAPSQSSPPEQPQSMEMRSVLRKAGSPRKARRARLNPLVLLLDAALTGELEVVQQAVKEMNDPSQPNEEGITALHNAICGANYSIVDFLITAGANVNSPDSHGWTPLHCAASCNDTVICMALVQHGAAIFATTLSDGATAFEKCDPYREGYADCATYLADVEQSMGLMNSGAVYALWDYSAEFGDELSFREGESVTVLRRDGPEETDWWWAALHGQEGYVPRNYFGLFPRVKPQRSKV

• Full Name: protein phosphatase 1, regulatory (inhibitor) subunit 13 like
• Calculated Molecular Weight: 89 kDa
• Observed Molecular Weight: 110 kDa
• GenBank Accession Number: BC064913
• Gene Symbol: PPP1R13L
• Gene ID (NCBI): 10848
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8WUF5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Inhibitor of apoptosis-stimulating protein of p53 (iASPP), encoded by PPP1R13L gene, is often overexpressed in human cancers. The ASPP family includes three members, namely ASPP1, ASPP2, and iASPP, which are specific regulators of p53-, p63-, and p73-mediated apoptosis. ASPP1 and ASPP2 enhance the apoptotic function of p53, whereas iASPP specifically inhibits p53-mediated apoptosis. Overexpression of iASPP is associated with resistance to cisplatin-induced apoptosis and rediation therapy. iASPP plays a pivotal role in regulating cancer cell proliferation and tumor progression.